DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dbf and Zfp346

DIOPT Version :9

Sequence 1:NP_609430.1 Gene:dbf / 34462 FlyBaseID:FBgn0287630 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_001365863.1 Gene:Zfp346 / 26919 MGIID:1349417 Length:310 Species:Mus musculus


Alignment Length:256 Identity:57/256 - (22%)
Similarity:87/256 - (33%) Gaps:59/256 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   403 QDLQSLFRWNYCALCNMVIRSTQSAIDHYSSRAHERRISSWLVRKCYANLTG----RDADALGGA 463
            |..|.||....|.:|..::.|....:.||.|:.|..::..:|.......:.|    .|:|.....
Mouse    64 QKNQCLFTSTQCKVCCAMLISESQKLAHYQSKKHANKVKRYLAIHGMETIKGDVKRLDSDQKSSR 128

  Fly   464 ISQSEFYCKLCDLKLTSLSHAQQHFLGRRH-------------RIAARHRIRPF---SDGFYDRE 512
            .......|.:|::..:|.:.||.|:||:.|             ...::|...||   |.....:.
Mouse   129 SKDKNHCCPICNMTFSSPAVAQSHYLGKTHAKSLKLKQQSTKGAALSKHLTNPFLVASTLALQQN 193

  Fly   513 GNWVRTDIKYPMCELCDVIITSESQMAMHLAGARHRRRVQIAYAGESAGGMEMGIGLVPFDGSHM 577
            ...:..|   ..|.||.......:....|..|.|||::             |..:.|:    :|.
Mouse   194 REMLDPD---KFCSLCHSTFNDPAMAQQHYMGKRHRKQ-------------ETKLKLM----AHY 238

  Fly   578 YRIRGNGSLAPIRPLGSQLLQGSAYPLSLTDPSAVFYCDACNITLNHLKSVNQHEQGRMHR 638
                  |.||.  |..|.|..|..||           |..|.|.||.::....|..|..|:
Mouse   239 ------GRLAD--PAVSDLPAGKGYP-----------CKTCKIVLNSIEQYQAHVSGFKHK 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dbfNP_609430.1 zf-met 524..547 CDD:289631 5/22 (23%)
ZnF_U1 613..640 CDD:197732 8/26 (31%)
Zfp346NP_001365863.1 ZnF_U1 75..104 CDD:197732 7/28 (25%)
C2H2 Zn finger 75..97 CDD:275371 6/21 (29%)
ZnF_U1 131..164 CDD:197732 9/32 (28%)
C2H2 Zn finger 136..158 CDD:275371 8/21 (38%)
ZnF_U1 198..232 CDD:197732 10/49 (20%)
C2H2 Zn finger 203..225 CDD:275371 5/21 (24%)
C2H2 Zn finger 257..279 CDD:275371 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838286
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8199
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565630at2759
OrthoFinder 1 1.000 - - FOG0001854
OrthoInspector 1 1.000 - - mtm8774
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6359
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.