DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dbf and ZNF385A

DIOPT Version :9

Sequence 1:NP_609430.1 Gene:dbf / 34462 FlyBaseID:FBgn0287630 Length:652 Species:Drosophila melanogaster
Sequence 2:XP_011536470.1 Gene:ZNF385A / 25946 HGNCID:17521 Length:419 Species:Homo sapiens


Alignment Length:413 Identity:81/413 - (19%)
Similarity:121/413 - (29%) Gaps:163/413 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   349 GQGQGQAQGAVPGFIPNHLQSRVAMVEPRIRQESLIKPQNPDLALPSEAHPPV---PQDLQSLFR 410
            |..|.|.:....|     |:..|.:|:....::..:....|   ||....||:   |.||:.:..
Human     9 GGKQNQKKRVARG-----LRLGVLLVQQAACRKGSLSRAGP---LPLLRQPPIMQPPLDLKQILP 65

  Fly   411 W------------NY----------------------------CALCNMVIRSTQSAIDHYSSRA 435
            :            ||                            |.:|.:...|...|..||....
Human    66 FPLEPAPTLGLFSNYSTMDPVQKAVLSHTFGGPLLKTKRPVISCNICQIRFNSQSQAEAHYKGNR 130

  Fly   436 HERRISSWLVRKCYANLTGRD-------------------------------------------- 456
            |.||:.....    |...||:                                            
Human   131 HARRVKGIEA----AKTRGREPGVREPGDPAPPGSTPTNGDGVAPRPVSMENGLGPAPGSPEKQP 191

  Fly   457 -------------------------ADALGGAISQSE-----FYCKLCDLKLTSLSHAQQHFLGR 491
                                     |...||:..:.|     .||.||.:.:.|||..:.|..|.
Human   192 GSPSPPSIPETGQGVTKGEGGTPAPASLPGGSKEEEEKAKRLLYCALCKVAVNSLSQLEAHNKGT 256

  Fly   492 RHR--IAARHRIRPFSDGFYDREGNWVRTDIKYPM------CELCDVIITSESQMAMHLAGARHR 548
            :|:  :.||..:.|..  .|.|.|.....:.:.|.      ||:|:|.:.||.|:..|::..|||
Human   257 KHKTILEARSGLGPIK--AYPRLGPPTPGEPEAPAQDRTFHCEICNVKVNSEVQLKQHISSRRHR 319

  Fly   549 ------------RRVQIAYAGESAGGM--------EMGIGLVPFD-GSHMYRIRGNGSLAPIRPL 592
                        |..:...|||.||.:        .:..||:|.. ..........||...:||.
Human   320 DGVAGKPNPLLSRHKKSRGAGELAGTLTFSKELPKSLAGGLLPSPLAVAAVMAAAAGSPLSLRPA 384

  Fly   593 -GSQLLQGS--AYPLSLTDPSAV 612
             .:.||||.  .:||....|..:
Human   385 PAAPLLQGPPITHPLLHPAPGPI 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dbfNP_609430.1 zf-met 524..547 CDD:289631 8/28 (29%)
ZnF_U1 613..640 CDD:197732 81/413 (20%)
ZNF385AXP_011536470.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
21.870

Return to query results.
Submit another query.