DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dbf and Zmat1

DIOPT Version :9

Sequence 1:NP_609430.1 Gene:dbf / 34462 FlyBaseID:FBgn0287630 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_780655.2 Gene:Zmat1 / 215693 MGIID:2442284 Length:647 Species:Mus musculus


Alignment Length:183 Identity:34/183 - (18%)
Similarity:70/183 - (38%) Gaps:44/183 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   403 QDLQSLFRWNYCALCNMVIRSTQSAIDHYSSRAHERRISSWLVRKCYANLTGRDADALG------ 461
            |:..:.|..|:|..|.:|::.....|.|:.|..|.:.:      |.:..:.|..::..|      
Mouse    28 QEQPAYFTDNFCKPCGVVLQHESERISHFESEIHAQNV------KFFFQMHGEQSEVPGRKVNMH 86

  Fly   462 ---------GAISQSEFYCKLCDLKLTSLSHAQQHFLGRRH------RIAARHRIRPFSDGFYDR 511
                     |.::::.| ..|.::...||:.|..|::|:.|      .:....::.|.:......
Mouse    87 AGNSQVCSSGEVNRNNF-TDLHNMSFDSLAAAPSHYVGKSHSPTQNQSLEEHDQVSPSTCSPKMD 150

  Fly   512 EGN-------WVRTDIKYP---------MCELCDVIITSESQMAMHLAGARHR 548
            |.|       ::::.|..|         :|.:|.:..||......|:.|..|:
Mouse   151 EPNTTPAPPPFLKSVIVKPPPAYRMRTYVCHICSITFTSLHMFRSHMQGTEHQ 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dbfNP_609430.1 zf-met 524..547 CDD:289631 6/22 (27%)
ZnF_U1 613..640 CDD:197732
Zmat1NP_780655.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838290
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565630at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.