DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dbf and ZNF385C

DIOPT Version :9

Sequence 1:NP_609430.1 Gene:dbf / 34462 FlyBaseID:FBgn0287630 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_001380491.1 Gene:ZNF385C / 201181 HGNCID:33722 Length:504 Species:Homo sapiens


Alignment Length:407 Identity:70/407 - (17%)
Similarity:107/407 - (26%) Gaps:194/407 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 LPSEAHPPVPQDLQSLFRWNYCALCNMVIRSTQSAIDHYSSRAHERRISSWLVRKCYANLTGRDA 457
            ||....||.|:..:....:..|.:||:.:.|...|..|...|||:||:....:.|..:...|..:
Human    24 LPRPPEPPKPKRERKRPSYTLCDVCNIQLNSAAQAQVHCGGRAHQRRLRQLSLGKSPSGPAGPAS 88

  Fly   458 DA----------------------------LGGAISQSEF------------------------- 469
            .|                            ..||...|.|                         
Human    89 GAPSPLLASLPLPTRPLQPPLDFKHLLAFHFNGAAPLSLFPNFSTMDPVQKAVISHTFGVPSPLK 153

  Fly   470 -----YCKLCDLKLTSLSHAQQHFLGRRHR------IAARHRIRPFS---DG------------- 507
                 .|.:|.|:..|.:.|:.|:.|.:|.      .||:.:.||.:   ||             
Human   154 KKLFISCNICHLRFNSANQAEAHYKGHKHARKLKAVEAAKSKQRPHTQAQDGAVVSPIPTLASGA 218

  Fly   508 ----------------------------------------------------------------- 507
                                                                             
Human   219 PGEPQSKAVPAAPPLGPPLQPPPTPDPTCREPAHSELLDAASSSSSSSCPPCSPEPGREAPGPEP 283

  Fly   508 -------FYDREGNWVRTDIKYPMCELCDVIITSESQMAMHLAGARHRRRVQIAYAGESAGGMEM 565
                   ....||   |::..:..|..|.|.:.|.||:..|..||:||..::    |:       
Human   284 AAAAVGSSMSGEG---RSEKGHLYCPTCKVTVNSASQLQAHNTGAKHRWMME----GQ------- 334

  Fly   566 GIGLVPFDGSHMYRIRGNGSLAPIRPLGSQLLQGSAYPLS---------LTDPSAVFYCDACNIT 621
                           ||    ||.|..|..:.:|.|...:         ...||..|:|..|.:.
Human   335 ---------------RG----APRRSRGRPVSRGGAGHKAKRVTGGRGGRQGPSPAFHCALCQLQ 380

  Fly   622 LNHLKSVNQHEQGRMHR 638
            :|....:.||...|.|:
Human   381 VNSETQLKQHMSSRRHK 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dbfNP_609430.1 zf-met 524..547 CDD:289631 9/22 (41%)
ZnF_U1 613..640 CDD:197732 8/26 (31%)
ZNF385CNP_001380491.1 ZnF_U1 45..74 CDD:197732 11/28 (39%)
ZnF_U1 160..187 CDD:197732 8/26 (31%)
C2H2 Zn finger 160..182 CDD:275371 7/21 (33%)
ZnF_U1 300..328 CDD:197732 9/27 (33%)
C2H2 Zn finger 305..373 CDD:275371 22/97 (23%)
ZnF_U1 369..401 CDD:197732 9/29 (31%)
C2H2 Zn finger 374..396 CDD:275371 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148191
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
21.890

Return to query results.
Submit another query.