DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dbf and znf385a

DIOPT Version :9

Sequence 1:NP_609430.1 Gene:dbf / 34462 FlyBaseID:FBgn0287630 Length:652 Species:Drosophila melanogaster
Sequence 2:XP_009295234.1 Gene:znf385a / 100147851 ZFINID:ZDB-GENE-090313-255 Length:423 Species:Danio rerio


Alignment Length:429 Identity:89/429 - (20%)
Similarity:149/429 - (34%) Gaps:133/429 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 PTVPRP----------AVKKPRHVAEL-----CLDSNGEYVLNKQLHQPLISRQPDPIIP----- 288
            |||.:|          .::.|.|...|     .:|...:.|:|.....||: :...|||.     
Zfish    19 PTVIQPHLDMKPFLQFPMETPPHSVGLFHNFNAMDPVQKAVINHTFGVPLV-KTKRPIISCNVCQ 82

  Fly   289 ----SVSSRDPHYFIQNQSHQLESAIKGLNGYTNVAQESEKPKNGYKYQPAAFADQRIVLQPKLG 349
                |.|..:.||    :.::....:||:....:..||::|...|....|:              
Zfish    83 IRFNSESQAEAHY----KGNRHARRVKGIETSKSRPQENDKTPPGPVSSPS-------------- 129

  Fly   350 QGQGQAQGAVPGFIPNHLQSRVAMVEPRIRQESLIKPQ--NPDLAL--PSEAHPPVPQDLQSLFR 410
                 ..||:| .||:        .:|....|:..:||  .|.:||  .:.::||.|:....   
Zfish   130 -----PTGALP-TIPD--------TDPSKTDETRPEPQLNGPAVALGPMTVSNPPTPESPGP--- 177

  Fly   411 WNYCALCNMVIRSTQSAIDHYSSRAHERRISSWLVRKCYANLTGRDADALGGAIS------QSE- 468
                :.|.::...|.......||.:          ..|.::...:......||.|      ::| 
Zfish   178 ----SACPLLPTPTTPQPPPASSSS----------PSCGSSNPEQAGTGAPGAPSVTPSNPETEE 228

  Fly   469 ------FYCKLCDLKLTSLSHAQQHFLGRRHR--IAARHRIRPFSDGFYDREG-----------N 514
                  .||.||.:.:.|||..:.|..|.:|:  :.||..:.|..  .|.|.|           .
Zfish   229 DKAKKLLYCSLCKVAVNSLSQLEAHNKGTKHKTILEARSGLGPIK--AYPRLGPKPSREQGGGAT 291

  Fly   515 WVRTDIKYPMCELCDVIITSESQMAMHLAGARHRRRV----------QIAYAGESAGGM--EMGI 567
            ...|..:...||:|:|.:.||.|:..|::..|||..|          ...:.|.....:  .:|.
Zfish   292 DPNTQERTFHCEICNVRVNSELQLKQHISSRRHRDGVAGKPNPLLSRHKKHRGADLADLTKALGA 356

  Fly   568 GLVPFDGSHMYRIRGNGSLAPIRPLGSQLLQGSAYPLSL 606
            ||:|               :|:....:.....|:.||:|
Zfish   357 GLLP---------------SPLAVAAAMAAAASSNPLAL 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dbfNP_609430.1 zf-met 524..547 CDD:289631 8/22 (36%)
ZnF_U1 613..640 CDD:197732
znf385aXP_009295234.1 C2H2 Zn finger 78..100 CDD:275371 4/25 (16%)
zf-met 78..100 CDD:289631 4/25 (16%)
zf-met 236..259 CDD:289631 9/22 (41%)
C2H2 Zn finger 237..259 CDD:275371 8/21 (38%)
zf-met 301..324 CDD:289631 8/22 (36%)
C2H2 Zn finger 302..324 CDD:275371 8/21 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582111
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.800

Return to query results.
Submit another query.