DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dbf and znf346

DIOPT Version :9

Sequence 1:NP_609430.1 Gene:dbf / 34462 FlyBaseID:FBgn0287630 Length:652 Species:Drosophila melanogaster
Sequence 2:XP_002936996.3 Gene:znf346 / 100135716 XenbaseID:XB-GENE-967544 Length:354 Species:Xenopus tropicalis


Alignment Length:301 Identity:62/301 - (20%)
Similarity:106/301 - (35%) Gaps:74/301 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 HLQSRVAMVEPRIRQESLIKPQNPDLALPSEAHPPVPQDLQSLFRWNYCALCNMVIRSTQSAIDH 430
            |.|||....:.| |..|:.:.:....|...:|.|....|...  |...|.:|||...|...|..|
 Frog    52 HYQSRKHANKVR-RYMSIHQGEELVSAKKFKAAPAESSDGDD--RSKCCPICNMTFSSPVVAESH 113

  Fly   431 YSSRAHERRI---------SSWL--VRKCYANLTGRDADALGGAISQSE--FYCKLCDLKLTSLS 482
            ||.:.|.:.:         ...|  .:|.....|...|..:...:.||:  .:||||.....:..
 Frog   114 YSGKTHIKNLRLREQGGVTEGMLHQAKKLVVTRTPTIATKIDNRMDQSDPTKFCKLCHATFNNPL 178

  Fly   483 HAQQHFLGRRHRIAARHRIRPFSDGFYDREGNW-----VRTDIKYPM-----------CELCDVI 531
            .|:||:.|::|:   :...:......|...|:.     :..::..|:           |:.|:::
 Frog   179 MAEQHYAGKKHK---KQETKTQLMTIYTSSGHTPAQAPIAINVNSPLPGSGSAGKGFSCDTCNIV 240

  Fly   532 ITSESQMAMHLAGARHRRRVQ----------------------------IAYAGESAGGMEMGIG 568
            :.|..|...|::||:|:.::.                            ::..|.||.|.....|
 Frog   241 LNSIEQYQAHVSGAKHKNQLMSMTPLSKEGPPAAGGPSALAGPPSTGGALSSGGPSARGFSASGG 305

  Fly   569 LVPFDGSHMYRIRGNGSLAPIRPLGSQLLQGSAYPLSLTDP 609
            ..|         :|..|...:.|:|.  |....||...:.|
 Frog   306 PTP---------KGPSSFGGLPPMGG--LMPPPYPPPHSQP 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dbfNP_609430.1 zf-met 524..547 CDD:289631 7/33 (21%)
ZnF_U1 613..640 CDD:197732
znf346XP_002936996.3 ZnF_U1 36..65 CDD:197732 5/13 (38%)
C2H2 Zn finger 36..58 CDD:275371 4/5 (80%)
ZnF_U1 92..126 CDD:197732 11/35 (31%)
C2H2 Zn finger 97..119 CDD:275371 9/21 (43%)
ZnF_U1 165..195 CDD:197732 9/32 (28%)
C2H2 Zn finger 167..189 CDD:275371 8/21 (38%)
zf-met 232..256 CDD:403930 7/23 (30%)
C2H2 Zn finger 234..256 CDD:275371 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565630at2759
OrthoFinder 1 1.000 - - FOG0001854
OrthoInspector 1 1.000 - - otm47911
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6359
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.