DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dbf and zmat4b

DIOPT Version :9

Sequence 1:NP_609430.1 Gene:dbf / 34462 FlyBaseID:FBgn0287630 Length:652 Species:Drosophila melanogaster
Sequence 2:XP_017213517.2 Gene:zmat4b / 100005974 ZFINID:ZDB-GENE-091118-68 Length:229 Species:Danio rerio


Alignment Length:261 Identity:52/261 - (19%)
Similarity:92/261 - (35%) Gaps:71/261 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   408 LFRWNYCALCNMVIRSTQSAIDHYSSRAHERRISSWLVRK-----CYANLTGRDADALGGAISQS 467
            ||..:||.:|:..:.|....:.||.||.|..::..:.:..     |.|.....|..:..|.:.::
Zfish    10 LFTDSYCKVCSAQLISESQRVAHYESRKHANKVRLYYMLHPVDGGCPAKKLRTDNGSADGDVDKN 74

  Fly   468 EFYCKLCDLKLTSLSHAQQHFLGRRHRIAARHRI----------------------RPFSDGFYD 510
            : .|.||::..||...||.|:.|:.|  |.|.|:                      ..:.||...
Zfish    75 K-CCTLCNMSFTSAVVAQSHYQGKIH--AKRLRLLLGEPAAIMSKEVTVEPDHMMDEDWKDGSPS 136

  Fly   511 REGNWVRTDIKYPMCELCDVIITSESQMAMHLAGARHRRRVQIAYAGESAGGMEMGIGLVPFDGS 575
            ..|.     :....|::|.....:......|..|.:|::.      |..|..:.. :|....||.
Zfish   137 TNGK-----LSQRYCQMCKAWFNNPGMARQHYNGKKHKKN------GAQANLLAQ-LGKTLEDGE 189

  Fly   576 HMYRIRGNGSLAPIRPLGSQLLQGSAYPLSLTDPSAVFYCDACNITLNHLKSVNQHEQGRMHRRN 640
            .|..::.:.:                             |:.|::|||.:...:.|.||..|:.|
Zfish   190 EMNGLKRSHT-----------------------------CEVCSVTLNSVAQYHAHLQGSKHQNN 225

  Fly   641 M 641
            :
Zfish   226 L 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dbfNP_609430.1 zf-met 524..547 CDD:289631 4/22 (18%)
ZnF_U1 613..640 CDD:197732 9/26 (35%)
zmat4bXP_017213517.2 ZnF_U1 15..45 CDD:197732 9/29 (31%)
C2H2 Zn finger 16..38 CDD:275371 7/21 (33%)
C2H2 Zn finger 77..99 CDD:275371 9/21 (43%)
zf-met 77..99 CDD:315537 9/21 (43%)
DUF3449 <111..>199 CDD:331240 14/99 (14%)
ZnF_U1 142..171 CDD:197732 5/28 (18%)
C2H2 Zn finger 146..168 CDD:275371 4/21 (19%)
zf-met 199..222 CDD:315537 8/51 (16%)
C2H2 Zn finger 200..222 CDD:275371 8/21 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565630at2759
OrthoFinder 1 1.000 - - FOG0001854
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_170663
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.