DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17097 and AT1G73750

DIOPT Version :9

Sequence 1:NP_609429.1 Gene:CG17097 / 34461 FlyBaseID:FBgn0265264 Length:1087 Species:Drosophila melanogaster
Sequence 2:NP_001323220.1 Gene:AT1G73750 / 843710 AraportID:AT1G73750 Length:468 Species:Arabidopsis thaliana


Alignment Length:191 Identity:43/191 - (22%)
Similarity:75/191 - (39%) Gaps:65/191 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   738 ETNYV-TSEDGYRLCLHR-IPRPGA----EPVLLVHGLMASSASWVELGPKDGLAYILYRKGYDV 796
            |.:|| .....:|:.|.| :|.|.|    .|:||:.|:..::.:: :|.|:...|..:...|:|.
plant    61 ELHYVPVPNSDWRVALWRYLPSPKAPKRNHPLLLLSGIGTNAVTY-DLSPECSFARSMSGSGFDT 124

  Fly   797 WMLNTRG---------------------------NIYS------------------RENLNRR-- 814
            |:|..||                           |..|                  ::.|::|  
plant   125 WILELRGAGLSSLSVDTNLGKGNNQQRIVSNLLENFISVSERLENVLDGGSKILGMQDRLSKRAG 189

  Fly   815 -------LKPNKYWDFSFHEIGKFDVPAAIDHILIHTHKP--KIQYIGHSQGSTVFFVMCS 866
                   |.|:..|||..:.  :.|||:|:|::...|...  |:..:|||.|..:.:.:.|
plant   190 DFKQRFELIPHYNWDFDNYL--EEDVPSAMDYVRTQTKSKDGKLLAVGHSMGGILLYALLS 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17097NP_609429.1 Abhydro_lipase 726..780 CDD:282003 13/47 (28%)
MhpC 746..1061 CDD:223669 40/182 (22%)
Abhydrolase_5 762..>899 CDD:289465 34/161 (21%)
AT1G73750NP_001323220.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11005
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.