DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17097 and Lipf

DIOPT Version :9

Sequence 1:NP_609429.1 Gene:CG17097 / 34461 FlyBaseID:FBgn0265264 Length:1087 Species:Drosophila melanogaster
Sequence 2:NP_080610.1 Gene:Lipf / 67717 MGIID:1914967 Length:395 Species:Mus musculus


Alignment Length:360 Identity:125/360 - (34%)
Similarity:194/360 - (53%) Gaps:17/360 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   729 LIEKYGYPSETNYVTSEDGYRLCLHRIP-------RPGAEPV-LLVHGLMASSASWVELGPKDGL 785
            :|..:|||||...|.:||||.|.::|||       ..|..|| .|.|||:||:.:|:...|.:.|
Mouse    37 MITYWGYPSEEYEVVTEDGYILGVYRIPYGKKNSENIGKRPVAYLQHGLIASATNWITNLPNNSL 101

  Fly   786 AYILYRKGYDVWMLNTRGNIYSRENLNRRLKPNKYWDFSFHEIGKFDVPAAIDHILIHTHKPKIQ 850
            |:||...|||||:.|:|||.:||:|:.......::|.|||.|:.|:|:||.||.|:..|.:.||.
Mouse   102 AFILADAGYDVWLGNSRGNTWSRKNVYYSPDSVEFWAFSFDEMAKYDLPATIDFIVQKTGQEKIH 166

  Fly   851 YIGHSQGSTVFFVMCSERPNYAHKVNLMQALSPTVYLQENRSPVLKFLGMFKGKYSMLLNLLGGY 915
            |:|||||:|:.|:..|..|..|.|:....||:|...::...||..|...:.|    .||.::.|.
Mouse   167 YVGHSQGTTIGFIAFSTNPALAKKIKRFYALAPVATVKYTESPFKKISLIPK----FLLKVIFGN 227

  Fly   916 EISAKTKLIQQF-RQHICSGSELGSSICAIFDFVLCGFDWKSFNTTLTPIVAAHASQGASAKQIY 979
            ::......:.|| ...:|| .||...:|:...|:.||||.|:.|.:...:...|...|.|.:.::
Mouse   228 KMFMPHNYLDQFLGTEVCS-RELLDLLCSNALFIFCGFDKKNLNVSRFDVYLGHNPAGTSTQDLF 291

  Fly   980 HYAQLQGDLNFQRFDHGAVL-NRVRYESSEPPAYNLSQTTSKVVLHHGEGDWLGSTSDVIRLQER 1043
            |:|||......|.::.|:.| |.:.|....||.|::|..|..:.:.:|..|.|....||..|..:
Mouse   292 HWAQLAKSGKLQAYNWGSPLQNMLHYNQKTPPYYDVSAMTVPIAVWNGGHDILADPQDVAMLLPK 356

  Fly  1044 LPNLVESRKVNFEGFSHFDFTLSKDVRPLLYSHVL 1078
            ||||:..:::  ..::|.||..:.|....:|:.::
Mouse   357 LPNLLYHKEI--LPYNHLDFIWAMDAPQEVYNEIV 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17097NP_609429.1 Abhydro_lipase 726..780 CDD:282003 25/58 (43%)
MhpC 746..1061 CDD:223669 112/324 (35%)
Abhydrolase_5 762..>899 CDD:289465 59/137 (43%)
LipfNP_080610.1 PLN02872 35..389 CDD:215470 125/358 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831804
Domainoid 1 1.000 227 1.000 Domainoid score I2491
eggNOG 1 0.900 - - E2759_KOG2624
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D408561at33208
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.