DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17097 and Gm8978

DIOPT Version :9

Sequence 1:NP_609429.1 Gene:CG17097 / 34461 FlyBaseID:FBgn0265264 Length:1087 Species:Drosophila melanogaster
Sequence 2:NP_001310180.1 Gene:Gm8978 / 668106 MGIID:3647649 Length:399 Species:Mus musculus


Alignment Length:370 Identity:108/370 - (29%)
Similarity:180/370 - (48%) Gaps:24/370 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   722 TKLTTVDLIEKYGYPSETNYVTSEDGYRLCLHRIPR-----PGAEPVLLV---HGLMASSASWVE 778
            :.:...::|:.:.||||...|.::|||.|.::|||.     ....|.::|   |||.:::..||.
Mouse    29 SNMNVSEIIKHWEYPSEEYEVVTDDGYILPINRIPHGKNNANSTAPKMVVFCLHGLFSTAGIWVS 93

  Fly   779 LGPKDGLAYILYRKGYDVWMLNTRGNIYSRENLNRRLKPNKYWDFSFHEIGKFDVPAAIDHILIH 843
            ..|.:.||:||...|||||:.|.||:..:::::.......::|.||:.|:.|:|:||.|..||..
Mouse    94 NPPDNSLAFILADAGYDVWLGNNRGSTRAKKHVTLNTDSKEFWAFSYDEMIKYDLPAIIKFILEK 158

  Fly   844 THKPKIQYIGHSQGSTVFFVMCSERPNYAHKVNLMQALSP--TV-YLQ-ENRSPVLKFLGMFKGK 904
            |.:.:|.|.|||||:.:.....:.....|.|:.|...::|  || |:: ..|.|.......||  
Mouse   159 TGQKQIYYTGHSQGTLIALGAFATNQELAEKIKLSILIAPVHTVKYVKGAGRLPAYFTPTAFK-- 221

  Fly   905 YSMLLNLLGGYEISAKTKLIQQFRQHICSGSELGSSICAIFDFVLCGFDWKSFNTTLTPIVAAHA 969
                  ::.|.:....||:..:..||:|. .:|..:.||.....|.|:..:.|||:...:...|:
Mouse   222 ------IVFGEKEFFPTKVFSRLSQHVCD-IKLVDAGCATVLGSLTGYSPEQFNTSRIDVYITHS 279

  Fly   970 SQGASAKQIYHYAQLQGDLNFQRFDHGA-VLNRVRYESSEPPAYNLSQTTSKVVLHHGEGDWLGS 1033
            ...:|.:.:.||.|......||.:|.|: .||...|..:.||.||:........:..|..|:|.:
Mouse   280 LGESSIQILIHYGQAIRSGVFQAYDWGSPSLNMQHYNQTTPPVYNVEDMKVPTAMFSGLKDFLSN 344

  Fly  1034 TSDVIRLQERLPNLVESRKVNFEGFSHFDFTLSKDVRPLLYSHVL 1078
            ..||..|..::.||...:.::  .|||.||.:..:.|..:...:|
Mouse   345 PEDVANLVPKISNLTYHKIIS--DFSHLDFIMGLNARKEVSEEIL 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17097NP_609429.1 Abhydro_lipase 726..780 CDD:282003 20/61 (33%)
MhpC 746..1061 CDD:223669 97/327 (30%)
Abhydrolase_5 762..>899 CDD:289465 48/143 (34%)
Gm8978NP_001310180.1 PLN02872 17..391 CDD:215470 108/370 (29%)
Abhydro_lipase 33..94 CDD:282003 20/60 (33%)
Abhydrolase_5 77..242 CDD:289465 53/172 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831855
Domainoid 1 1.000 227 1.000 Domainoid score I2491
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D408561at33208
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.