DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17097 and CG11600

DIOPT Version :9

Sequence 1:NP_609429.1 Gene:CG17097 / 34461 FlyBaseID:FBgn0265264 Length:1087 Species:Drosophila melanogaster
Sequence 2:NP_650217.2 Gene:CG11600 / 41555 FlyBaseID:FBgn0038068 Length:406 Species:Drosophila melanogaster


Alignment Length:375 Identity:113/375 - (30%)
Similarity:191/375 - (50%) Gaps:38/375 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   724 LTTVDLIEKYGYPSETNYVTSEDGYRLCLHRIP------RPGAEP-VLLVHGLMASSASWVELGP 781
            :|.:.:|:||||..||:.|.:.|||.|.:.|||      ..|.:| ||:.|||::.:.|::..||
  Fly    41 ITGILIIDKYGYSVETHTVRTGDGYILDMFRIPSSPNCKEDGFKPSVLIQHGLISLADSFLVTGP 105

  Fly   782 KDGLAYILYRKGYDVWMLNTRGNIYSRENLNRRLKPNKYWDFSFHEIGKFDVPAAIDHILIHTHK 846
            :.||.::|..:.||||:.|:||..||:.::..:...:.:|.||:||:|..|:||.||:||..|::
  Fly   106 RSGLPFMLADRCYDVWLSNSRGVRYSQRHIRLKASQDAFWRFSWHEMGMEDLPAMIDYILSTTNE 170

  Fly   847 PKIQYIGHSQGSTVFFVMCSERPNYAHKVNLMQALSPTVYLQENRSPVLKFLG---------MFK 902
            ..:.::.||||.|...|:.|.:|.|...:.....::|.|:::..|:.::|..|         .|.
  Fly   171 EALHFVCHSQGCTTLLVLLSMKPEYNRMIKTANMMAPAVFMKHARNKLMKMFGNIIMSMKDSSFF 235

  Fly   903 GKYSMLLNLLGGYEISAKTKLIQQFRQHICSGSELGSSICAIFDFVLCGFDWKSF-NTTLTPIVA 966
            |....:..||..:                |..|:. ..:|| |.|:|...:..|: |.|..|::.
  Fly   236 GPLDAIRFLLSVF----------------CKCSKF-KKLCA-FMFILASEEPTSYMNNTAIPLIL 282

  Fly   967 AHASQGASAKQIYHYAQLQGDLNFQRFDHGAVLNRVRYESSEPPAYNLS--QTTSKVVLHHGEGD 1029
            |......|.:|..|:.||:....|:.:|.|.:.|:..|....||.|.|.  :..|.:.::|..||
  Fly   283 ATHPGAISTRQPKHFLQLRKSGKFRPYDFGVMRNKKLYNQDTPPDYPLENVRPQSPIHIYHSHGD 347

  Fly  1030 WLGSTSDVIRLQERLPNLVESRKVNFEGFSHFDFTLSKDVRPLLYSHVLR 1079
            .|.:..|:..|..:|...| ...|.||.:||.||..:|.::.::...:::
  Fly   348 DLVARKDIHILISKLDKAV-LHDVVFEKWSHSDFLFAKLIKKVVNEPIIK 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17097NP_609429.1 Abhydro_lipase 726..780 CDD:282003 23/60 (38%)
MhpC 746..1061 CDD:223669 100/333 (30%)
Abhydrolase_5 762..>899 CDD:289465 48/137 (35%)
CG11600NP_650217.2 PLN02872 46..396 CDD:215470 112/368 (30%)
Abhydro_lipase 46..104 CDD:282003 23/57 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439551
Domainoid 1 1.000 150 1.000 Domainoid score I1414
eggNOG 1 0.900 - - E2759_KOG2624
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D39202at50557
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 1 1.000 - - otm46497
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.