DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17097 and LIPA

DIOPT Version :9

Sequence 1:NP_609429.1 Gene:CG17097 / 34461 FlyBaseID:FBgn0265264 Length:1087 Species:Drosophila melanogaster
Sequence 2:NP_000226.2 Gene:LIPA / 3988 HGNCID:6617 Length:399 Species:Homo sapiens


Alignment Length:377 Identity:124/377 - (32%)
Similarity:195/377 - (51%) Gaps:30/377 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   723 KLTTVD---------LIEKYGYPSETNYVTSEDGYRLCLHRIPR-------PGAEPVL-LVHGLM 770
            |||.||         :|..:|:|||...|.:||||.|||:|||.       .|.:||: |.|||:
Human    25 KLTAVDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLL 89

  Fly   771 ASSASWVELGPKDGLAYILYRKGYDVWMLNTRGNIYSRENLNRRLKPNKYWDFSFHEIGKFDVPA 835
            |.|::||.......|.:||...|:||||.|:|||.:||::....:..:::|.||:.|:.|:|:||
Human    90 ADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPA 154

  Fly   836 AIDHILIHTHKPKIQYIGHSQGSTVFFVMCSERPNYAHKVNLMQALSPTVYLQENRSPVLKFLGM 900
            :|:.||..|.:.::.|:|||||:|:.|:..|:.|..|.::.:..||.|...:....||:.| ||.
Human   155 SINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAK-LGR 218

  Fly   901 FKGKYSMLLNLLGGYEISAKTKLIQQFRQHICSG---SELGSSICAIFDFVLCGFDWKSFNTTLT 962
            ...  .::.:|.|..|...::..::....|:|:.   .||..::|    |:||||:.::.|.:..
Human   219 LPD--HLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLC----FLLCGFNERNLNMSRV 277

  Fly   963 PIVAAHASQGASAKQIYHYAQLQGDLNFQRFDHG-AVLNRVRYESSEPPAYNLSQTTSKVVLHHG 1026
            .:...|:..|.|.:.:.|::|......||.||.| :..|...|..|.||.||:........:..|
Human   278 DVYTTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSG 342

  Fly  1027 EGDWLGSTSDVIRLQERLPNLVESRKVNFEGFSHFDFTLSKDVRPLLYSHVL 1078
            ..|||....||..|..::.|||....:  ..:.|.||....|....||:.::
Human   343 GHDWLADVYDVNILLTQITNLVFHESI--PEWEHLDFIWGLDAPWRLYNKII 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17097NP_609429.1 Abhydro_lipase 726..780 CDD:282003 29/70 (41%)
MhpC 746..1061 CDD:223669 106/326 (33%)
Abhydrolase_5 762..>899 CDD:289465 53/137 (39%)
LIPANP_000226.2 PLN02872 38..396 CDD:215470 119/364 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141852
Domainoid 1 1.000 222 1.000 Domainoid score I2592
eggNOG 1 0.900 - - E2759_KOG2624
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D408561at33208
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.