DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17097 and Lipo3

DIOPT Version :9

Sequence 1:NP_609429.1 Gene:CG17097 / 34461 FlyBaseID:FBgn0265264 Length:1087 Species:Drosophila melanogaster
Sequence 2:NP_001013792.2 Gene:Lipo3 / 381236 MGIID:2147592 Length:399 Species:Mus musculus


Alignment Length:372 Identity:108/372 - (29%)
Similarity:179/372 - (48%) Gaps:40/372 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   728 DLIEKYGYPSETNYVTSEDGYRLCLHRIPR-----PGAEPVLLV---HGLMASSASWVELGPKDG 784
            ::|:.:.||||...|.::|||.|.::|||.     ..:.|.::|   |||:|:..:||...|.:.
Mouse    35 EIIKHWDYPSEEYEVVTDDGYILPINRIPHGKNNANSSAPKMVVFCQHGLLATPGAWVSNPPVNS 99

  Fly   785 LAYILYRKGYDVWMLNTRGNIYSRENLNRRLKPNKYWDFSFHEIGKFDVPAAIDHILIHTHKPKI 849
            ||:||...||||||.::||:.::::::.......::|||||.::.|:|:||.|:.||..|.:.:|
Mouse   100 LAFILADAGYDVWMGSSRGSTWAKKHVALNPDSKEFWDFSFDQMIKYDLPATINFILDKTGQKQI 164

  Fly   850 QYIGHSQGSTVFFVMCSERPNYAHKVNLMQALSPTVYLQENRSPVLKFLGMFKGKYSMLLNLLGG 914
            .|||||||:.:.....:.....|.|:.|...|:|...:|.::.                ::.|..
Mouse   165 YYIGHSQGTLLAIGAFATNQTLAEKIKLNILLAPIYSVQHSKG----------------ISHLAS 213

  Fly   915 YEISAKTKLI---QQFRQHICSGSELGSSICAI-FDFVLC--------GFDWKSFNTTLTPIVAA 967
            |......||:   ::|...:.. ||:|:.:|.| |...:|        |:.....|.:...:...
Mouse   214 YLTPTTIKLLFGEKEFFPTVVF-SEVGACVCNINFFTAICAAIMGSMGGYSPDQLNKSRLDVYVK 277

  Fly   968 HASQGASAKQIYHYAQLQGDLNFQRFDHGA-VLNRVRYESSEPPAYNLSQTTSKVVLHHGEGDWL 1031
            ....|.|.|.:.||.|:......|.:|.|: .||...|..:.||.||:........:..|..|:|
Mouse   278 LNLAGTSVKVLIHYNQVGRSGILQAYDWGSPSLNMQHYNQTTPPVYNVEDMKVPTAMFTGLKDFL 342

  Fly  1032 GSTSDVIRLQERLPNLVESRKVNFEGFSHFDFTLSKDVRPLLYSHVL 1078
            ....||..|:.::.||...:.:  ..||||||.|..:.|..:...:|
Mouse   343 SDPEDVEILKPKIHNLTYLKTI--PDFSHFDFILGLNARKEVSEEIL 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17097NP_609429.1 Abhydro_lipase 726..780 CDD:282003 21/59 (36%)
MhpC 746..1061 CDD:223669 95/335 (28%)
Abhydrolase_5 762..>899 CDD:289465 48/139 (35%)
Lipo3NP_001013792.2 PLN02872 34..391 CDD:215470 108/372 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831852
Domainoid 1 1.000 227 1.000 Domainoid score I2491
eggNOG 1 0.900 - - E2759_KOG2624
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D408561at33208
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.