DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17097 and CG31871

DIOPT Version :9

Sequence 1:NP_609429.1 Gene:CG17097 / 34461 FlyBaseID:FBgn0265264 Length:1087 Species:Drosophila melanogaster
Sequence 2:NP_723607.1 Gene:CG31871 / 34463 FlyBaseID:FBgn0051871 Length:531 Species:Drosophila melanogaster


Alignment Length:393 Identity:156/393 - (39%)
Similarity:243/393 - (61%) Gaps:9/393 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   694 KNRINVVTPEYKVFKTPNYL-----TQEDILDNTKLTTVDLIEKYGYPSETNYVTSEDGYRLCLH 753
            ||.:|.|.    :...||..     .:.|:|::..|.|..||.||||||||:.|.::|||.|.:|
  Fly    46 KNLLNSVL----LSSNPNLAGGGRNLKSDVLEDASLITPKLIRKYGYPSETHTVVTKDGYILEMH 106

  Fly   754 RIPRPGAEPVLLVHGLMASSASWVELGPKDGLAYILYRKGYDVWMLNTRGNIYSRENLNRRLKPN 818
            |||:.||:||||:||::.:||:||.:|||.||.|:|...||||||.|:|||.||:.:.:......
  Fly   107 RIPKKGAQPVLLMHGILDTSATWVLMGPKSGLGYMLSDLGYDVWMGNSRGNRYSKNHTSLNSDYQ 171

  Fly   819 KYWDFSFHEIGKFDVPAAIDHILIHTHKPKIQYIGHSQGSTVFFVMCSERPNYAHKVNLMQALSP 883
            ::|||:|||:||:|:||.||:||..|...::.|||||||:.:|:|:|||:|.|..|:..|.||:|
  Fly   172 EFWDFTFHEMGKYDLPANIDYILSKTGYEQVHYIGHSQGTAIFWVLCSEQPAYTQKITSMHALAP 236

  Fly   884 TVYLQENRSPVLKFLGMFKGKYSMLLNLLGGYEISAKTKLIQQFRQHICSGSELGSSICAIFDFV 948
            ..|:.:.:||:.:.|.:|....:....:|...|....||.:....|.:|..:.:...:|:...|:
  Fly   237 IAYIHDMKSPLFRTLVLFLDFLTAATRMLRITEFMPNTKFLVDHSQVVCHDNAMTQDVCSNILFL 301

  Fly   949 LCGFDWKSFNTTLTPIVAAHASQGASAKQIYHYAQLQGDLNFQRFDHGAVLNRVRYESSEPPAYN 1013
            :.|::.:..|.|:.|::.:|...|||.||:.|:.||....:|::||.|.:.|::.|....||.|:
  Fly   302 VAGYNSEQLNKTMLPVMLSHTPSGASIKQLEHFGQLMKSGHFRKFDRGYLRNQLEYNRMTPPDYD 366

  Fly  1014 LSQTTSKVVLHHGEGDWLGSTSDVIRLQERLPNLVESRKVNFEGFSHFDFTLSKDVRPLLYSHVL 1078
            ||:....|.|::...|.|.||:.|.||...|||:::...|..|.|:|.||..:.||:||:|:.::
  Fly   367 LSRVKVPVALYYSVNDLLVSTTGVDRLARELPNVIDKYLVPMERFNHLDFLWAIDVKPLVYNRLV 431

  Fly  1079 RHL 1081
            |::
  Fly   432 RNV 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17097NP_609429.1 Abhydro_lipase 726..780 CDD:282003 32/53 (60%)
MhpC 746..1061 CDD:223669 126/314 (40%)
Abhydrolase_5 762..>899 CDD:289465 67/136 (49%)
CG31871NP_723607.1 Abhydro_lipase 79..133 CDD:282003 32/53 (60%)
MhpC 93..436 CDD:223669 136/342 (40%)
Abhydrolase_5 115..281 CDD:289465 73/165 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438247
Domainoid 1 1.000 150 1.000 Domainoid score I1414
eggNOG 1 0.900 - - E2759_KOG2624
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D39202at50557
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 1 1.000 - - otm46497
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.