DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17097 and LIPM

DIOPT Version :9

Sequence 1:NP_609429.1 Gene:CG17097 / 34461 FlyBaseID:FBgn0265264 Length:1087 Species:Drosophila melanogaster
Sequence 2:XP_011538050.1 Gene:LIPM / 340654 HGNCID:23455 Length:430 Species:Homo sapiens


Alignment Length:382 Identity:122/382 - (31%)
Similarity:195/382 - (51%) Gaps:33/382 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   728 DLIEKYGYPSETNYVTSEDGYRLCLHRIPR-------PGAEP-VLLVHGLMASSASWVELGPKDG 784
            ::|:..|||.|...|.:||||.|.::||||       .|:.| |||.|||:..:::|:...|.:.
Human    51 EIIQHQGYPCEEYEVATEDGYILSVNRIPRGLVQPKKTGSRPVVLLQHGLVGGASNWISNLPNNS 115

  Fly   785 LAYILYRKGYDVWMLNTRGNIYSRENLNRRLKPNKYWDFSFHEIGKFDVPAAIDHILIHTHKPKI 849
            |.:||...|:||||.|:|||.:||::....:..:::|.||:.|:.:||:||.|:.||..|.:.||
Human   116 LGFILADAGFDVWMGNSRGNAWSRKHKTLSIDQDEFWAFSYDEMARFDLPAVINFILQKTGQEKI 180

  Fly   850 QYIGHSQGSTVFFVMCSERPNYAHKVNLMQALSPTVYLQENRSPVLKFL----GMFKGKYSMLLN 910
            .|:|:|||:|:.|:..|..|..|.|:.:..||:|...::..:||..|||    .|.||       
Human   181 YYVGYSQGTTMGFIAFSTMPELAQKIKMYFALAPIATVKHAKSPGTKFLLLPDMMIKG------- 238

  Fly   911 LLGGYEISAKTKLIQQFRQHICSGSELGSSICAIFDFVLCGFDWKSFN-------TTLTPIVAAH 968
            |.|..|...:|:.::|...::| |..:...||:....:|.||:..:.|       .:...:.|||
Human   239 LFGKKEFLYQTRFLRQLVIYLC-GQVILDQICSNIMLLLGGFNTNNMNMNTHGLLQSRASVYAAH 302

  Fly   969 ASQGASAKQIYHYAQLQGDLNFQRFDHGA-VLNRVRYESSEPPAYNLSQTTSKVVLHHGEGDWLG 1032
            ...|.|.:.|.|::|.......:.||.|: ..|..:.....|..|.:...|....:..|..|||.
Human   303 TLAGTSVQNILHWSQAVNSGELRAFDWGSETKNLEKCNQPTPVRYRVRDMTVPTAMWTGGQDWLS 367

  Fly  1033 STSDVIRLQERLPNLVESRKVNFEGFSHFDFTLSKDVRPLLYS---HVLRHLSTSLS 1086
            :..||..|...:.||:..:  |...::|.||....|....:|:   |:::...|:||
Human   368 NPEDVKMLLSEVTNLIYHK--NIPEWAHVDFIWGLDAPHRMYNEIIHLMQQEETNLS 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17097NP_609429.1 Abhydro_lipase 726..780 CDD:282003 24/59 (41%)
MhpC 746..1061 CDD:223669 106/334 (32%)
Abhydrolase_5 762..>899 CDD:289465 56/141 (40%)
LIPMXP_011538050.1 Abhydro_lipase 49..111 CDD:282003 24/59 (41%)
Abhydrolase_1 92..399 CDD:278959 100/316 (32%)
Abhydrolase_5 93..>231 CDD:289465 55/137 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141832
Domainoid 1 1.000 222 1.000 Domainoid score I2592
eggNOG 1 0.900 - - E2759_KOG2624
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D408561at33208
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.