DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18284 and AT1G73750

DIOPT Version :9

Sequence 1:NP_001285807.1 Gene:CG18284 / 34460 FlyBaseID:FBgn0043825 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001323220.1 Gene:AT1G73750 / 843710 AraportID:AT1G73750 Length:468 Species:Arabidopsis thaliana


Alignment Length:191 Identity:43/191 - (22%)
Similarity:70/191 - (36%) Gaps:65/191 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 ETHYAFTADG-YKLCLHR-IPRSGAT----PVLLVHGLMASSATWVQFGPSQGLAYILSQSGYDV 169
            |.||....:. :::.|.| :|...|.    |:||:.|:..::.|: ...|....|..:|.||:|.
plant    61 ELHYVPVPNSDWRVALWRYLPSPKAPKRNHPLLLLSGIGTNAVTY-DLSPECSFARSMSGSGFDT 124

  Fly   170 WMLNTRG-------------------------------------NVYS--------EERLAGRES 189
            |:|..||                                     ||..        ::||:.|..
plant   125 WILELRGAGLSSLSVDTNLGKGNNQQRIVSNLLENFISVSERLENVLDGGSKILGMQDRLSKRAG 189

  Fly   190 D---------KIFWDFSFHEIGQYDLPAAIDLILLQTKMP--SIQYIGHSQGSTAFFVMCS 239
            |         ...|||..:.  :.|:|:|:|.:..|||..  .:..:|||.|....:.:.|
plant   190 DFKQRFELIPHYNWDFDNYL--EEDVPSAMDYVRTQTKSKDGKLLAVGHSMGGILLYALLS 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18284NP_001285807.1 Abhydro_lipase 99..150 CDD:282003 12/44 (27%)
PLN02872 101..450 CDD:215470 43/191 (23%)
Abhydrolase_5 135..>250 CDD:289465 36/161 (22%)
AT1G73750NP_001323220.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11005
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.