DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18284 and LOC100360690

DIOPT Version :9

Sequence 1:NP_001285807.1 Gene:CG18284 / 34460 FlyBaseID:FBgn0043825 Length:457 Species:Drosophila melanogaster
Sequence 2:XP_006231366.1 Gene:LOC100360690 / 100360690 RGDID:2321667 Length:399 Species:Rattus norvegicus


Alignment Length:376 Identity:119/376 - (31%)
Similarity:183/376 - (48%) Gaps:33/376 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 DAKLETPKMISKYGHQVETHYAFTADGYKLCLHRIP---------RSGATPVL-LVHGLMASSAT 148
            :|.:...::||.:|::.|.|...|.|||.|.:.|||         .:...||: |.|||..|:..
  Rat    29 EANMNVSQIISYWGYESEEHEVMTEDGYILLIFRIPHGKNENKSSHNTRRPVVYLHHGLTVSADY 93

  Fly   149 WVQFGPSQGLAYILSQSGYDVWMLNTRGNVYSEERLAGRESDKIFWDFSFHEIGQYDLPAAIDLI 213
            |:...||..||::|:.:|::||:.|:||...:.:.:......|.||||||:|..:|||||.|..|
  Rat    94 WILDPPSNCLAFLLADAGFEVWLGNSRGTNNARKHVRLDPDSKEFWDFSFNEQIEYDLPAIIYFI 158

  Fly   214 LLQTKMPSIQYIGHSQGSTAFFVMCSERPEYAGKISLMQSLSPSVYMEGTRSPALKFMKLFSGGF 278
            |.:|:...|.|||||||....:...:..|:.|.||.:..:|.|.|           ..|..:|.|
  Rat   159 LNETRQTQIYYIGHSQGVYLAYAAFATNPQLAQKIKINFALGPVV-----------ITKYLTGVF 212

  Fly   279 --------TMLLNLLGGHKISLKNKIVDMFRNHICTKLIPSRICAIFEFVVCGFNFNSFNMTLSP 335
                    |::..:.|...|..|:...|:.| .:|.:...:..|.....|:.|:|..:.|.:...
  Rat   213 RTIAYIHPTVIKTMFGEKDIFSKSNANDILR-FLCHREQIATACTSLLIVLFGYNPGNLNESRID 276

  Fly   336 ILEGHASQGSSAKQIYHFAQLQGNSAFQKYDYGL-ILNKIRYQSIFPPLYNLSLALGKVALHRGD 399
            :...|...|:|.:.|.||:|...:..||.||:|. .||.:.|....||:||:.....:.|:..|:
  Rat   277 VYSEHIPAGTSVRSILHFSQGIRSGLFQAYDWGSESLNVLHYNQSTPPIYNIEDMKVRTAMWSGE 341

  Fly   400 GDWLGSESDVLRLERDLPNCIENRNIRFEGFSHFDFTISKDVRSLVYDRVI 450
            .|.||...||..|....||.|.::.|  ..::|.||.:.||....||.::|
  Rat   342 RDLLGDPKDVKNLAAKTPNLIYHKKI--PHYNHMDFILGKDAVVQVYRKII 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18284NP_001285807.1 Abhydro_lipase 99..150 CDD:282003 20/60 (33%)
PLN02872 101..450 CDD:215470 117/367 (32%)
Abhydrolase_5 135..>250 CDD:289465 48/115 (42%)
LOC100360690XP_006231366.1 Abhydro_lipase 34..96 CDD:282003 21/61 (34%)
Abhydrolase_1 79..378 CDD:278959 100/312 (32%)
Abhydrolase_5 79..245 CDD:289465 60/177 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335534
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55134
OrthoDB 1 1.010 - - D408561at33208
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11005
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X80
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.960

Return to query results.
Submit another query.