DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31872 and CG3635

DIOPT Version :9

Sequence 1:NP_001285806.1 Gene:CG31872 / 34458 FlyBaseID:FBgn0051872 Length:1073 Species:Drosophila melanogaster
Sequence 2:NP_610138.4 Gene:CG3635 / 35447 FlyBaseID:FBgn0032981 Length:425 Species:Drosophila melanogaster


Alignment Length:375 Identity:121/375 - (32%)
Similarity:192/375 - (51%) Gaps:24/375 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   710 IDAKLDTPKMISKYGHQAETHYAFTADGYKLCLHRIP---------RSGATPVL-LVHGLMASSD 764
            :|....|...||.:.:..|.|...|.|.|.|.::|||         |:|...|: |.||::::||
  Fly    45 VDGHKVTATSISNHNYPVEEHTVITHDDYILTIYRIPSSPNRSHLNRAGRRAVVFLQHGILSASD 109

  Fly   765 TWVQFGPSQGLAYILSQSGYDVWMLNTRGNVYSEERLAGRESDKIFWDFSFHEIGQYDLPAAIDL 829
            .|:..||...|||:|:.:|||||:.|.|||.||.:..........||.||:||||.|||.|.:|.
  Fly   110 DWIINGPEASLAYMLADAGYDVWLGNARGNTYSRQHKHIHPDTSDFWRFSWHEIGVYDLAAMLDY 174

  Fly   830 ILLQTKMPSIQYIGHSQGSTAFFVMCSERPEYAGKISLMQSLSPSVYMEGTRSPALKFMKVLQGG 894
            .|.:::..|:.::.||||:|||||:.|..|.|..|:..:..|:|..||........|...:..|.
  Fly   175 ALAKSQSSSLHFVAHSQGTTAFFVLMSSLPLYNEKLRSVHLLAPIAYMRDHSFILSKLGGIFLGT 239

  Fly   895 FTMLLNLLGGHKISLKNRIVDMFRNHICNKLIPSRICAIFEFV-------VCGFNFNSFNMTLSP 952
            .:.|..:||..::.....:..:...|||:.      .::|.|:       :.|:.....|.||.|
  Fly   240 PSFLSWVLGSMELLPITNLQKLICEHICSS------SSMFNFLCSGLLDFIGGWGTRHLNQTLLP 298

  Fly   953 ILEGHASQGSSAKQIYHFAQLQGNSAFQKYDYGLILNKIRYQSIFPPLYNLSLALGKVALHRGDG 1017
            .:......|:|:.|:.|:.||..:..|::||:|..||:|.||...||.||:......|.::..:.
  Fly   299 DVCATHPAGASSSQVIHYLQLYRSGDFRQYDHGPELNEIIYQQPTPPSYNVQYIKSCVDMYYSEN 363

  Fly  1018 DWLGSESDVLRLERDLPNCIENRNIRFEGFSHFDFTISKDVRSLVYDRVI 1067
            |::.:..||..|...|| |.:...|.|..::|:||..|.:|:.::.:::|
  Fly   364 DYMSAVGDVKYLASLLP-CAQLYRIPFRDWNHYDFLWSNNVKEVINNKII 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31872NP_001285806.1 Abhydro_lipase 716..767 CDD:282003 20/60 (33%)
Abhydrolase_5 752..>894 CDD:289465 57/142 (40%)
CG3635NP_610138.4 Abhydro_lipase 55..115 CDD:282003 20/59 (34%)
Abhydrolase_1 97..399 CDD:278959 103/308 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439460
Domainoid 1 1.000 150 1.000 Domainoid score I1414
eggNOG 1 0.900 - - E2759_KOG2624
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D39202at50557
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 1 1.000 - - otm46497
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.