DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31872 and CG18284

DIOPT Version :9

Sequence 1:NP_001285806.1 Gene:CG31872 / 34458 FlyBaseID:FBgn0051872 Length:1073 Species:Drosophila melanogaster
Sequence 2:NP_001285807.1 Gene:CG18284 / 34460 FlyBaseID:FBgn0043825 Length:457 Species:Drosophila melanogaster


Alignment Length:461 Identity:393/461 - (85%)
Similarity:406/461 - (88%) Gaps:29/461 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   623 VEALAQSLTQ----------AHAQIQEQAQSQSQSQEQDQSQSQAPNERQSQLQSQRQDQDQGPK 677
            |.:|..|.||          .:..:.||.|.|||||.|.|..||  ::.|:|:||          
  Fly    15 VGSLVPSKTQEWVPYAYPVDENQGLNEQTQWQSQSQIQSQGTSQ--SQSQAQIQS---------- 67

  Fly   678 FDDDLDEQPAPRSCSQCQKASYPQYITEVDIEIDAKLDTPKMISKYGHQAETHYAFTADGYKLCL 742
                   ||.||||.|||:|||.|:..||||:|||||:|||||||||||.|||||||||||||||
  Fly    68 -------QPEPRSCLQCQQASYQQFFAEVDIQIDAKLETPKMISKYGHQVETHYAFTADGYKLCL 125

  Fly   743 HRIPRSGATPVLLVHGLMASSDTWVQFGPSQGLAYILSQSGYDVWMLNTRGNVYSEERLAGRESD 807
            |||||||||||||||||||||.|||||||||||||||||||||||||||||||||||||||||||
  Fly   126 HRIPRSGATPVLLVHGLMASSATWVQFGPSQGLAYILSQSGYDVWMLNTRGNVYSEERLAGRESD 190

  Fly   808 KIFWDFSFHEIGQYDLPAAIDLILLQTKMPSIQYIGHSQGSTAFFVMCSERPEYAGKISLMQSLS 872
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   191 KIFWDFSFHEIGQYDLPAAIDLILLQTKMPSIQYIGHSQGSTAFFVMCSERPEYAGKISLMQSLS 255

  Fly   873 PSVYMEGTRSPALKFMKVLQGGFTMLLNLLGGHKISLKNRIVDMFRNHICNKLIPSRICAIFEFV 937
            |||||||||||||||||:..|||||||||||||||||||:||||||||||.||||||||||||||
  Fly   256 PSVYMEGTRSPALKFMKLFSGGFTMLLNLLGGHKISLKNKIVDMFRNHICTKLIPSRICAIFEFV 320

  Fly   938 VCGFNFNSFNMTLSPILEGHASQGSSAKQIYHFAQLQGNSAFQKYDYGLILNKIRYQSIFPPLYN 1002
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   321 VCGFNFNSFNMTLSPILEGHASQGSSAKQIYHFAQLQGNSAFQKYDYGLILNKIRYQSIFPPLYN 385

  Fly  1003 LSLALGKVALHRGDGDWLGSESDVLRLERDLPNCIENRNIRFEGFSHFDFTISKDVRSLVYDRVI 1067
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   386 LSLALGKVALHRGDGDWLGSESDVLRLERDLPNCIENRNIRFEGFSHFDFTISKDVRSLVYDRVI 450

  Fly  1068 DLCGSN 1073
            .|||||
  Fly   451 SLCGSN 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31872NP_001285806.1 Abhydro_lipase 716..767 CDD:282003 48/50 (96%)
Abhydrolase_5 752..>894 CDD:289465 137/141 (97%)
CG18284NP_001285807.1 Abhydro_lipase 99..150 CDD:282003 48/50 (96%)
PLN02872 101..450 CDD:215470 341/348 (98%)
Abhydrolase_5 135..>250 CDD:289465 113/114 (99%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438224
Domainoid 1 1.000 150 1.000 Domainoid score I1414
eggNOG 1 0.900 - - E2759_KOG2624
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D39202at50557
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 1 1.000 - - otm46497
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.