DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7329 and AT1G73750

DIOPT Version :9

Sequence 1:NP_001260357.1 Gene:CG7329 / 34457 FlyBaseID:FBgn0032271 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001323220.1 Gene:AT1G73750 / 843710 AraportID:AT1G73750 Length:468 Species:Arabidopsis thaliana


Alignment Length:431 Identity:80/431 - (18%)
Similarity:140/431 - (32%) Gaps:168/431 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 HQVTTDDKYILTLHRIARPGA-------------------KPVLLVHGLEDTSSTWIVMGPESGL 101
            :::.|.|:    ||.:..|.:                   .|:||:.|: .|::....:.||...
plant    54 NEICTADE----LHYVPVPNSDWRVALWRYLPSPKAPKRNHPLLLLSGI-GTNAVTYDLSPECSF 113

  Fly   102 GYFLYANGYDVWMGNVRGNRYSKGHVKLN-----------PNTDKSYWS---------------- 139
            ...:..:|:|.|:..:||...|...|..|           .|..:::.|                
plant   114 ARSMSGSGFDTWILELRGAGLSSLSVDTNLGKGNNQQRIVSNLLENFISVSERLENVLDGGSKIL 178

  Fly   140 ----------------------FSWHEIGMY---DLPAMIDGVLQKTGYQ--KLSYFGHSQGTTS 177
                                  ::| :...|   |:|:.:|.|..:|..:  ||...|||.|...
plant   179 GMQDRLSKRAGDFKQRFELIPHYNW-DFDNYLEEDVPSAMDYVRTQTKSKDGKLLAVGHSMGGIL 242

  Fly   178 FFVMAS------------------SRPEYNAKIHLMSALAPVAFMKH----MKAPLMGIARMGMN 220
            .:.:.|                  |..:|::...|:..|.|   ||.    :..|:|.|..| :.
plant   243 LYALLSRCGFKGMDSGLAGVTTLASTFDYSSSGTLLKYLLP---MKEPAQAINLPIMPIDTM-LA 303

  Fly   221 MFGDNFELFPHSEVFLNQCLSSAAMLKTCMRFYWQIVGKNREEQNMTMFPVVLGHLPGGCNIKQA 285
            |........|:|..:|...:|:..|:..      :::.|           :||..|   |.:...
plant   304 MAHPLMCRPPYSLSWLTANISAPQMMDP------EVIEK-----------LVLNSL---CTVPVK 348

  Fly   286 LHYLQM----------QKSDRFCQYDYESKENQRLYGRSTPPDYRLERIKAPVALYYGSNDYLSA 340
            | .||:          .::..||..|:.||.|                  .|:....|..|.:..
plant   349 L-LLQLTTAVDHGGLRDRTGTFCYKDHISKTN------------------VPILALAGDWDIICP 394

  Fly   341 VEDVHRLAKVLPNVVENHL--YR--------KWNHMDMIWG 371
            .:.|:...|::|    .||  |:        .:.|.|:|.|
plant   395 PDAVYDTVKLIP----EHLATYKVVGSPGGPHYGHQDLISG 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7329NP_001260357.1 Abhydro_lipase 42..96 CDD:282003 10/58 (17%)
Abhydrolase 73..239 CDD:304388 47/260 (18%)
Abhydrolase_1 77..371 CDD:278959 74/389 (19%)
AT1G73750NP_001323220.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11005
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.