DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7329 and AT1G15060

DIOPT Version :9

Sequence 1:NP_001260357.1 Gene:CG7329 / 34457 FlyBaseID:FBgn0032271 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001319006.1 Gene:AT1G15060 / 838071 AraportID:AT1G15060 Length:578 Species:Arabidopsis thaliana


Alignment Length:291 Identity:62/291 - (21%)
Similarity:102/291 - (35%) Gaps:79/291 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 WSFSWHEIGMYDLPAMIDGV----LQKTGYQKLSYFGHSQGTTSFFVMAS--------------- 183
            |.|. |.: ..|:||.|:.|    ..|.|  ||...|||.|....:.|.|               
plant   329 WDFD-HYL-EEDVPAAIEYVRAQSKPKDG--KLFAIGHSMGGILLYAMLSRCAFEGREPSVAAVA 389

  Fly   184 ---SRPEYNAKIHLMSALAPVAFMKHMKAPLMGIARMGMNMFGDNFELF---PHSEVFLNQCLSS 242
               |..:|......:..|.|:|  ...:|..:.:..:|. :....|.|.   |:...:||..:||
plant   390 TLASSVDYTTSNSALKLLIPLA--NPAEALSVPVVPLGA-LLAAAFPLSTRPPYVLSWLNDLISS 451

  Fly   243 AAMLKTCMRFYWQIVGKNREEQNMTMFPVVLGH---LPGGCNIKQALHYLQMQKSDRFCQYDYES 304
            ..|:...|                 :..:||.:   :|....|:....:.:....||..::.|:.
plant   452 TDMMHPEM-----------------LEKLVLNNFCTIPAKLLIQLTTAFREGGLRDRSGKFYYKD 499

  Fly   305 KENQRLYGRSTPPDYRLERIKAPVALYYGSNDYL---SAVEDVHRLAKVLP-NVVENHLYRK--- 362
                           .|.|...||....|..|.:   :||||.   .|:.| |:|...|..:   
plant   500 ---------------HLPRTSVPVLALAGDRDLICPPAAVEDT---VKLFPENLVTYKLLGEPDG 546

  Fly   363 --WNHMDMIWGISARRSIQPRILQVMQYWET 391
              :.|.|::.|..|...:.|.|.:.:.:.::
plant   547 PHYAHYDLVGGRLAVEQVYPCITEFLSHHDS 577

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7329NP_001260357.1 Abhydro_lipase 42..96 CDD:282003
Abhydrolase 73..239 CDD:304388 30/125 (24%)
Abhydrolase_1 77..371 CDD:278959 58/269 (22%)
AT1G15060NP_001319006.1 Hydrolase_4 <330..545 CDD:403389 55/256 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11005
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.