DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7329 and CG17097

DIOPT Version :9

Sequence 1:NP_001260357.1 Gene:CG7329 / 34457 FlyBaseID:FBgn0032271 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_609429.1 Gene:CG17097 / 34461 FlyBaseID:FBgn0265264 Length:1087 Species:Drosophila melanogaster


Alignment Length:379 Identity:144/379 - (37%)
Similarity:223/379 - (58%) Gaps:26/379 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VIEDAHLNTIQLLEKYKHPAETHQVTTDDKYILTLHRIARPGAKPVLLVHGLEDTSSTWIVMGPE 98
            ::::..|.|:.|:|||.:|:||:.||::|.|.|.||||.||||:||||||||..:|::|:.:||:
  Fly   718 ILDNTKLTTVDLIEKYGYPSETNYVTSEDGYRLCLHRIPRPGAEPVLLVHGLMASSASWVELGPK 782

  Fly    99 SGLGYFLYANGYDVWMGNVRGNRYSKGHV--KLNPNTDKSYWSFSWHEIGMYDLPAMIDGVLQKT 161
            .||.|.||..||||||.|.|||.||:.::  :|.||   .||.||:||||.:|:||.||.:|..|
  Fly   783 DGLAYILYRKGYDVWMLNTRGNIYSRENLNRRLKPN---KYWDFSFHEIGKFDVPAAIDHILIHT 844

  Fly   162 GYQKLSYFGHSQGTTSFFVMASSRPEYNAKIHLMSALAPVAFMKHMKAPLM-------GIARMGM 219
            ...|:.|.|||||:|.||||.|.||.|..|::||.||:|..:::..::|::       |...|.:
  Fly   845 HKPKIQYIGHSQGSTVFFVMCSERPNYAHKVNLMQALSPTVYLQENRSPVLKFLGMFKGKYSMLL 909

  Fly   220 NMFGDNFELFPHSEVFLNQ-----CLSSAAMLKTCMRFYWQIVGKNREEQNMTMFPVVLGHLPGG 279
            |:.| .:|:...::: :.|     |..|......|..|.:.:.|.:.:..|.|:.|:|..|...|
  Fly   910 NLLG-GYEISAKTKL-IQQFRQHICSGSELGSSICAIFDFVLCGFDWKSFNTTLTPIVAAHASQG 972

  Fly   280 CNIKQALHYLQMQKSDRFCQYDYESKENQRLYGRSTPPDYRLERIKAPVALYYGSNDYLSAVEDV 344
            .:.||..||.|:|....|.::|:.:..|:..|..|.||.|.|.:..:.|.|::|..|:|.:..||
  Fly   973 ASAKQIYHYAQLQGDLNFQRFDHGAVLNRVRYESSEPPAYNLSQTTSKVVLHHGEGDWLGSTSDV 1037

  Fly   345 HRLAKVLPNVVENHL--YRKWNHMDMIWGISARRSIQPRIL-QVMQYWETGGGG 395
            .||.:.|||:||:..  :..::|.|    .:..:.::|.:. .|:::..|...|
  Fly  1038 IRLQERLPNLVESRKVNFEGFSHFD----FTLSKDVRPLLYSHVLRHLSTSLSG 1087

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7329NP_001260357.1 Abhydro_lipase 42..96 CDD:282003 31/53 (58%)
Abhydrolase 73..239 CDD:304388 80/179 (45%)
Abhydrolase_1 77..371 CDD:278959 118/309 (38%)
CG17097NP_609429.1 Abhydro_lipase 726..780 CDD:282003 31/53 (58%)
MhpC 746..1061 CDD:223669 127/319 (40%)
Abhydrolase_5 762..>899 CDD:289465 70/139 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438241
Domainoid 1 1.000 150 1.000 Domainoid score I1414
eggNOG 1 0.900 - - E2759_KOG2624
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D39202at50557
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 1 1.000 - - otm46497
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.