DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7329 and CG31872

DIOPT Version :9

Sequence 1:NP_001260357.1 Gene:CG7329 / 34457 FlyBaseID:FBgn0032271 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001285806.1 Gene:CG31872 / 34458 FlyBaseID:FBgn0051872 Length:1073 Species:Drosophila melanogaster


Alignment Length:379 Identity:149/379 - (39%)
Similarity:203/379 - (53%) Gaps:29/379 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 TYPASVIE-----DAHLNTIQLLEKYKHPAETHQVTTDDKYILTLHRIARPGAKPVLLVHGLEDT 88
            :||..:.|     ||.|:|.:::.||.|.||||...|.|.|.|.||||.|.||.||||||||..:
  Fly   698 SYPQYITEVDIEIDAKLDTPKMISKYGHQAETHYAFTADGYKLCLHRIPRSGATPVLLVHGLMAS 762

  Fly    89 SSTWIVMGPESGLGYFLYANGYDVWMGNVRGNRYSKGHVKLNPNTDKSYWSFSWHEIGMYDLPAM 153
            |.||:..||..||.|.|..:||||||.|.|||.||:..: ....:||.:|.||:||||.|||||.
  Fly   763 SDTWVQFGPSQGLAYILSQSGYDVWMLNTRGNVYSEERL-AGRESDKIFWDFSFHEIGQYDLPAA 826

  Fly   154 IDGVLQKTGYQKLSYFGHSQGTTSFFVMASSRPEYNAKIHLMSALAPVAFMKHMKAP-------L 211
            ||.:|.:|....:.|.|||||:|:||||.|.||||..||.||.:|:|..:|:..::|       |
  Fly   827 IDLILLQTKMPSIQYIGHSQGSTAFFVMCSERPEYAGKISLMQSLSPSVYMEGTRSPALKFMKVL 891

  Fly   212 MGIARMGMNMFGDNFELFPHS--------EVFLNQCLSSAAMLKTCMRFYWQIVGKNREEQNMTM 268
            .|...|.:|:.|.      |.        ::|.|...:.....:.|..|.:.:.|.|....|||:
  Fly   892 QGGFTMLLNLLGG------HKISLKNRIVDMFRNHICNKLIPSRICAIFEFVVCGFNFNSFNMTL 950

  Fly   269 FPVVLGHLPGGCNIKQALHYLQMQKSDRFCQYDYESKENQRLYGRSTPPDYRLERIKAPVALYYG 333
            .|::.||...|.:.||..|:.|:|.:..|.:|||....|:..|....||.|.|......|||:.|
  Fly   951 SPILEGHASQGSSAKQIYHFAQLQGNSAFQKYDYGLILNKIRYQSIFPPLYNLSLALGKVALHRG 1015

  Fly   334 SNDYLSAVEDVHRLAKVLPNVVENH--LYRKWNHMDMIWGISARRSIQPRILQV 385
            ..|:|.:..||.||.:.|||.:||.  .:..::|.|.......|..:..|::.:
  Fly  1016 DGDWLGSESDVLRLERDLPNCIENRNIRFEGFSHFDFTISKDVRSLVYDRVIDL 1069

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7329NP_001260357.1 Abhydro_lipase 42..96 CDD:282003 30/53 (57%)
Abhydrolase 73..239 CDD:304388 82/180 (46%)
Abhydrolase_1 77..371 CDD:278959 122/310 (39%)
CG31872NP_001285806.1 Abhydro_lipase 716..767 CDD:282003 29/50 (58%)
Abhydrolase_5 752..>894 CDD:289465 72/142 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438242
Domainoid 1 1.000 150 1.000 Domainoid score I1414
eggNOG 1 0.900 - - E2759_KOG2624
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D39202at50557
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 1 1.000 - - otm46497
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.