DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7329 and LIPJ

DIOPT Version :9

Sequence 1:NP_001260357.1 Gene:CG7329 / 34457 FlyBaseID:FBgn0032271 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001010939.2 Gene:LIPJ / 142910 HGNCID:21773 Length:366 Species:Homo sapiens


Alignment Length:374 Identity:116/374 - (31%)
Similarity:196/374 - (52%) Gaps:37/374 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LNTIQLLEKYKHPAETHQVTTDDKYILTLHRIARPGAKP---------------VLLVHGLEDTS 89
            :|..|::..:.:|.|.:.:.|:|.|||.|:||      |               |.|.|||..::
Human     1 MNISQIISYWGYPDEEYDIVTEDGYILGLYRI------PYWRTDNNKNLAQRVVVYLQHGLLTSA 59

  Fly    90 STWIVMGPESGLGYFLYANGYDVWMGNVRGNRYSKGHVKLNPNTDKSYWSFSWHEIGMYDLPAMI 154
            |:||...|.:.||:.|...||||||||.|||.:|:.|:.|. .:.|.:|:||:.|:..|||||.|
Human    60 SSWISNLPNNSLGFILADAGYDVWMGNSRGNTWSRKHLYLE-TSSKEFWAFSFDEMAKYDLPASI 123

  Fly   155 DGVLQKTGYQKLSYFGHSQGTTSFFVMASSRPEYNAKIHLMSALAPVAFMKHMKAPLMGIARMGM 219
            |..:::|..:::.|.|||||||..|:..|:..:...:|.:..|||||...|::|:||:.:.....
Human   124 DFTVKQTRQEEIFYVGHSQGTTIGFITFSTISKIAERIKIFFALAPVFSTKYLKSPLIRMTYKWK 188

  Fly   220 NM---FGDNFELFPHS--EVFLNQCLSSAAML-KTCMRFYWQIVGKNREEQNMTMFPVVLGHLPG 278
            ::   |..|.:..|.:  :.|:...|....:. |.|:...:.:.|.:.:..||:...|...|.|.
Human   189 SIVMAFSGNKDFLPKTSFKKFIGSKLCPLQIFDKICLNILFMMFGYDPKNLNMSRLDVYFSHNPA 253

  Fly   279 GCNIKQALHYLQMQKSDRFCQYDYESKE-NQRLYGRSTPPDYRLERIKAPVALYYGSNDYLSAVE 342
            |.:::..||:.|:..|.....||:.|.: |...|.::|.|.|.:..:....|::.|.:|.|:..|
Human   254 GTSVQNMLHWSQLLNSTHLKAYDWGSPDLNLVHYNQTTSPLYNMTNMNVATAIWNGKSDLLADPE 318

  Fly   343 DVHRLAKVLPNVVENHLYRK----WNHMDMIWGISARRSIQPRILQVMQ 387
            ||:    :|.:.:.||:|.|    :||:|.::|:.....:...|:.::|
Human   319 DVN----ILHSEITNHIYYKTISYYNHIDSLFGLDVYDQVYHEIIDIIQ 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7329NP_001260357.1 Abhydro_lipase 42..96 CDD:282003 20/68 (29%)
Abhydrolase 73..239 CDD:304388 64/185 (35%)
Abhydrolase_1 77..371 CDD:278959 101/319 (32%)
LIPJNP_001010939.2 Abhydro_lipase 3..66 CDD:282003 20/68 (29%)
Abhydrolase_5 47..209 CDD:289465 62/162 (38%)
Abhydrolase_1 48..347 CDD:278959 100/303 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141826
Domainoid 1 1.000 222 1.000 Domainoid score I2592
eggNOG 1 0.900 - - E2759_KOG2624
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 271 1.000 Inparanoid score I3005
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55134
OrthoDB 1 1.010 - - D408561at33208
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 1 1.000 - - mtm8502
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X80
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.910

Return to query results.
Submit another query.