DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SH3RF3 and B0303.7

DIOPT Version :9

Sequence 1:NP_001092759.1 Gene:SH3RF3 / 344558 HGNCID:24699 Length:882 Species:Homo sapiens
Sequence 2:NP_498918.3 Gene:B0303.7 / 176220 WormBaseID:WBGene00015128 Length:493 Species:Caenorhabditis elegans


Alignment Length:457 Identity:104/457 - (22%)
Similarity:174/457 - (38%) Gaps:124/457 - (27%)


- Green bases have known domain annotations that are detailed below.


Human   116 RLLDGIRQRP--RAGTSPG---GSPPARPIPGQSAAPTLAGGGGGAAGSTPGSPVFLSAAAGSTA 175
            |..|.:...|  |.|||||   ||..|  |..|.....: ||...::.|:..:|.:.|.:..|.:
 Worm   105 RKSDSVPPPPPHRGGTSPGKLSGSHSA--IRSQLENMHI-GGSVMSSNSSTATPSYQSNSTSSYS 166

Human   176 GSL----------RELATSRTAPAAKNPCLLPYGKALYSYEGKEPGDLKFNKGDIIVLRRKVDEQ 230
            .|.          .:...|.:|||...    |||.|.:.|...:..::....||.:::.:|||.:
 Worm   167 SSAPVAPPPVPRHTQSIPSYSAPAIST----PYGIAKFDYAPTQSDEMGLRIGDTVLISKKVDAE 227

Human   231 WYHGELHG--TQGFLPASYIQCIQPLPHA----PPQ------------GKALYDFEMKDKDQDKD 277
            |::||...  |.|.:|:||:....||..|    ||:            ..|:||:...:...   
 Worm   228 WFYGENQNQRTFGIVPSSYLDIKIPLKEAFTALPPRPAAPSGSSSGTYATAIYDYNSNEAGD--- 289

Human   278 CLTFTKDEILTVLRRVDENWAEGMLGDKIGIFPLLYVELNDSAKQLIEMDKPCPAAASSCNASLP 342
             |.|.....:.|..||:|.|.||....:.||||..:|:..:..:  :.|.:..|::|.|.:..:.
 Worm   290 -LNFAVGSQIMVTARVNEEWLEGECFGRSGIFPSQFVDCPNLYQ--VPMKQSAPSSAPSYSHPIT 351

Human   343 SDSGAVASVAPSPTLSSSGAVSAFQRRVDGKKNTKKRHSFTALSVTHRSSQAASHRHSMEISAPV 407
            ::||...:|..|....|  .|::..|..:|       ...|||.               :|.|..
 Worm   352 NNSGPKQTVTVSYDYDS--GVASDLRLFEG-------DVITALE---------------DIDAQW 392

Human   408 LISS-----------------SDPRAAARIGDLAHLSCAAPTQDVSSSAGSTPTAVPRAASVSGE 455
            |::.                 ..|:.|...| :|.::||..               |:.|..:|:
 Worm   393 LLAECRGQQGMVPKTFLGPPYGSPKKAPSKG-IAEIACAFS---------------PKKAVATGD 441

Human   456 QGTPPKVQLPLNVYLALYAYKPQKSDELELHKGEMYRVLEKCQDGWFKG--ASLRTGVSGVFPGN 518
                               |..:....|.:.:|:...::|...|.::||  .:.:|..:|:.|.|
 Worm   442 -------------------YHSEDPKHLYVTRGDHLLIVEDVDDYYYKGKLEAFKTLPAGILPKN 487

Human   519 YV 520
            .|
 Worm   488 IV 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SH3RF3NP_001092759.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..42
RING 56..98 CDD:238093
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..159 14/39 (36%)
SH3_SH3RF3_1 197..250 CDD:212861 18/54 (33%)
SH3_SH3RF3_2 260..314 CDD:212864 16/65 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 368..399 5/30 (17%)
Interaction with RAC1. /evidence=ECO:0000269|PubMed:20696164 369..439 13/86 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 433..458 3/24 (13%)
SH3_SH3RF3_3 467..523 CDD:212858 12/56 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 575..664
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 693..747
SH3_SH3RF_C 827..881 CDD:212719
B0303.7NP_498918.3 SH3 194..247 CDD:214620 17/52 (33%)
SH3 275..326 CDD:302595 16/54 (30%)
SH3 356..409 CDD:214620 12/76 (16%)
SH3 432..490 CDD:214620 15/92 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C161457397
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.