DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trim9 and TRIM55

DIOPT Version :9

Sequence 1:NP_001188786.1 Gene:Trim9 / 34453 FlyBaseID:FBgn0051721 Length:740 Species:Drosophila melanogaster
Sequence 2:NP_908973.1 Gene:TRIM55 / 84675 HGNCID:14215 Length:548 Species:Homo sapiens


Alignment Length:440 Identity:83/440 - (18%)
Similarity:135/440 - (30%) Gaps:173/440 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDELRCPTCKQLYANP-VLLPCFHALCLGCALDI---QTPYSPGSALPGAVNGAGAASAAGHNG 61
            :|.:|.||.|.:::..| |:|||.|.||..||.||   ..||.|                     
Human    20 LEKQLICPICLEMFTKPVVILPCQHNLCRKCASDIFQASNPYLP--------------------- 63

  Fly    62 LHGNGGGAGGGAAAPVTNPNGPGTRHSSHSSAASTASSNTGSESVTSDQDQSDKVSIFSEADSGV 126
            ..|....|.||.                                                     
Human    64 TRGGTTMASGGR----------------------------------------------------- 75

  Fly   127 VCCSNTSRPVSYAGTGLLPGVGNVVAPPGAAYCLTCPLCRKLVFFDDGGVRNLPTYRAMEAIVDR 191
                                             ..||.||..|..|..||..|.....:|.|:| 
Human    76 ---------------------------------FRCPSCRHEVVLDRHGVYGLQRNLLVENIID- 106

  Fly   192 FCAREALRCQMCETDPKVASLICEQCEIRYCDACRELTHPARGPLAKHTLVKPRGAAQQRESVCG 256
                                 |.:|          |.|.|.:               :..:.:|.
Human   107 ---------------------IYKQ----------ESTRPEK---------------KSDQPMCE 125

  Fly   257 EH-EETLSQYCLSCKAPACGLCIGELRHQAHDVQSINVTCKAQKTELSHNLQQLSEKARSTTEFI 320
            || ||.::.|||:|:.|.|.||.....|:...|..:....:.||:|||..:..|....       
Human   126 EHEEERINIYCLNCEVPTCSLCKVFGAHKDCQVAPLTHVFQRQKSELSDGIAILVGSN------- 183

  Fly   321 QRLKGMSDKVTESCMEFERLVHAQ----CEA---LIQAIHDRREYLLEAIRMDKDTKIRILKDQQ 378
            .|::|:..::.::|...|.....|    ||.   |...:.:|:..:.:.|...::.|:..::...
Human   184 DRVQGVISQLEDTCKTIEECCRKQKQELCEKFDYLYGILEERKNEMTQVITRTQEEKLEHVRALI 248

  Fly   379 SNCTGKLQQTTGLIQFCIEALKETDSAAFLQVGSMLINRVTNTDMTWHQE 428
            ...:..|:..:.|::..|:.:.|.:.|.|||....|:.:::.....:..|
Human   249 KKYSDHLENVSKLVESGIQFMDEPEMAVFLQNAKTLLKKISEASKAFQME 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trim9NP_001188786.1 RING-HC_TRIM9_like_C-I 2..37 CDD:319490 17/38 (45%)
zf-B_box 250..291 CDD:306989 15/41 (37%)
ClassIIa_HDAC_Gln-rich-N 298..420 CDD:330228 26/128 (20%)
FN3 472..564 CDD:238020
SPRY_PRY_TRIM67_9 561..735 CDD:293947
TRIM55NP_908973.1 RING 26..85 CDD:238093 26/165 (16%)
zf-B_box 119..161 CDD:279037 15/41 (37%)
iSH2_PI3K_IA_R 168..294 CDD:304922 26/132 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 326..532
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.