DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trim9 and Trim54

DIOPT Version :9

Sequence 1:NP_001188786.1 Gene:Trim9 / 34453 FlyBaseID:FBgn0051721 Length:740 Species:Drosophila melanogaster
Sequence 2:NP_067422.1 Gene:Trim54 / 58522 MGIID:1889623 Length:366 Species:Mus musculus


Alignment Length:420 Identity:80/420 - (19%)
Similarity:144/420 - (34%) Gaps:151/420 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDELRCPTCKQLYANP-VLLPCFHALCLGCALDIQTPYSPGSALPGAVNGAGAASAAGHNGLHG 64
            :|.:|.||.|.::::.| |:|||.|.||..||.|:                              
Mouse    20 LEKQLICPICLEMFSKPVVILPCQHNLCRKCANDV------------------------------ 54

  Fly    65 NGGGAGGGAAAPVTNPNGPGTRHSSHSSAASTASSNTGSESVTSDQDQSDKVSIFSEADSGVVCC 129
                                      ..|::....:.||.:|:|                     
Mouse    55 --------------------------FQASNPLWQSRGSTTVSS--------------------- 72

  Fly   130 SNTSRPVSYAGTGLLPGVGNVVAPPGAAYCLTCPLCRKLVFFDDGGVRNLPTYRAMEAIVDRFCA 194
                                     |..:  .||.||..|..|..||..|.....:|.|:|    
Mouse    73 -------------------------GGRF--RCPSCRHEVVLDRHGVYGLQRNLLVENIID---- 106

  Fly   195 REALRCQMCETDPKVASLICEQCEIRYCDACRELTHPARGPLAKHTLVKPRGAAQQRESVCGEHE 259
                                                     :.|....:|..|..::..:|.|||
Mouse   107 -----------------------------------------IYKQESSRPLHAKAEQHLMCEEHE 130

  Fly   260 -ETLSQYCLSCKAPACGLCIGELRHQAHDVQSINVTCKAQKTELSHNLQQLSEKARSTTEFIQRL 323
             |.::.|||||:.|.|.||.....|:..:|..:....|.||:|||..:..|..........|.::
Mouse   131 DEKINIYCLSCEVPTCSLCKVFGAHKDCEVAPLPTIYKRQKSELSDGIAMLVAGNDRVQAVITQM 195

  Fly   324 KGMSDKVTESCMEFERLVHAQCEALIQAIHDRREYLLEAIRMDKDTKIRILKDQQSNCTGKLQQT 388
            :.:...:.::....::|::.:.|.|...:.:|:..||:|:..:::.|::.::.........|:.:
Mouse   196 EEVCQTIEDNSRRQKQLLNQRFETLCAVLEERKGELLQALAREQEEKLQRVRGLIRQYGDHLEGS 260

  Fly   389 TGLIQFCIEALKETDSAAFLQVGSMLINRV 418
            :.|::..|::::|...|.:||....|||:|
Mouse   261 SKLVESAIQSMEEPQMALYLQQAKELINKV 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trim9NP_001188786.1 RING-HC_TRIM9_like_C-I 2..37 CDD:319490 16/35 (46%)
zf-B_box 250..291 CDD:306989 16/41 (39%)
ClassIIa_HDAC_Gln-rich-N 298..420 CDD:330228 26/121 (21%)
FN3 472..564 CDD:238020
SPRY_PRY_TRIM67_9 561..735 CDD:293947
Trim54NP_067422.1 RING 26..85 CDD:238093 24/162 (15%)
zf-B_box 125..163 CDD:279037 16/37 (43%)
Mediates microtubule-binding and homooligomerization 168..211 8/42 (19%)
iSH2_PI3K_IA_R 170..>273 CDD:304922 18/102 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..366
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.