DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trim9 and si:ch211-12p12.2

DIOPT Version :9

Sequence 1:NP_001188786.1 Gene:Trim9 / 34453 FlyBaseID:FBgn0051721 Length:740 Species:Drosophila melanogaster
Sequence 2:XP_001920571.1 Gene:si:ch211-12p12.2 / 558611 ZFINID:ZDB-GENE-131125-5 Length:453 Species:Danio rerio


Alignment Length:409 Identity:93/409 - (22%)
Similarity:155/409 - (37%) Gaps:89/409 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 AREALRCQMCE---TDPKVASL---ICEQC--------EIRYCDACRELT---HPARGPLAKH-- 239
            :.|...|.||.   .||.|.|.   .|::|        :.:.|..||..:   .|....:.|:  
Zfish     5 SEEDFSCPMCHDIFKDPVVLSCSHSFCKECLQQFWKTKKTQECPVCRRRSSKDFPPCNLVLKNLC 69

  Fly   240 -TLVKPRGAAQQRESVCGEHEETLSQYCLSCKAPACGLCIGELRHQAHDVQSINVTCKAQKTELS 303
             :.:|.|......|.:|..|.|.|..:||..|...|.:|:...:|..|..:.|.....:.|.:|:
Zfish    70 ESFLKERKYGCSSEEICSLHGEKLKLFCLEDKQLMCVVCVTSKQHDNHKFRPIGEVVSSHKKDLN 134

  Fly   304 HNLQQLSEKARSTTEF-------IQRLKGMSDKVTESCMEFERLVHAQCEALIQAIHDRREYLLE 361
            ..|:.|.||.:...:.       ||.:|..:|       :.|..:..|.|.|.|.:.|..|..:.
Zfish   135 TALKSLQEKIKHNKDIKEEFEKTIQHIKTQAD-------DTEHQIKQQFEKLHQFLRDEEEATIT 192

  Fly   362 AIRMDKDTKIRILKDQQSNCTGKLQQTTGLIQFCIEALKETDSAAFLQ--VGSMLINRVTNTDMT 424
            |:|.:::.|.:::|::.......:...:..|:...|.|| .:...||:  .|||...:::..|  
Zfish   193 ALREEEEQKRQVMKEKLEEMNTHISALSCTIRDTEEMLK-ANGVCFLKEFPGSMKRVQISQPD-- 254

  Fly   425 WHQEVTNAAPRVSPIVDLTLDDAALARAIDNLNFIQMRAVKDGDERCPAA--PMTPT---ILPSD 484
             .|..:.|...||             :.:.||.:...|.::|.....|..  |.|..   ||..|
Zfish   255 -PQTPSGALINVS-------------QYLGNLQYRVWRKMQDIVHYTPVILDPNTANPHLILSDD 305

  Fly   485 CSAENNSVTVAWQPPNHSFVEGYVLELDDGSGGEFREVYCGKETICTVDGLHFNS---MYNARVK 546
            .::...:......|||....:.|...|  ||.|                   |||   .::..||
Zfish   306 LTSGRGTGNRQPLPPNPERFDWYFCVL--GSEG-------------------FNSGKHSWDVEVK 349

  Fly   547 AFNSAGEGEYSELIGLQTA 565
              :::|.|     :|:.||
Zfish   350 --DNSGWG-----LGVTTA 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trim9NP_001188786.1 RING-HC_TRIM9_like_C-I 2..37 CDD:319490
zf-B_box 250..291 CDD:306989 12/40 (30%)
ClassIIa_HDAC_Gln-rich-N 298..420 CDD:330228 30/130 (23%)
FN3 472..564 CDD:238020 22/99 (22%)
SPRY_PRY_TRIM67_9 561..735 CDD:293947 3/5 (60%)
si:ch211-12p12.2XP_001920571.1 RING 11..52 CDD:238093 11/40 (28%)
zf-B_box 81..122 CDD:279037 12/40 (30%)
DUF4200 130..>219 CDD:290574 21/95 (22%)
SPRY 288..449 CDD:295394 24/102 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.