DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trim9 and mei-P26

DIOPT Version :9

Sequence 1:NP_001188786.1 Gene:Trim9 / 34453 FlyBaseID:FBgn0051721 Length:740 Species:Drosophila melanogaster
Sequence 2:NP_001356936.1 Gene:mei-P26 / 45775 FlyBaseID:FBgn0026206 Length:1310 Species:Drosophila melanogaster


Alignment Length:431 Identity:90/431 - (20%)
Similarity:166/431 - (38%) Gaps:56/431 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 ALDIQTPYSPGSALPGAVNGAGAASAAGHNGLHGNGGGAGGGAAAPVTNPNGPGTRHSSHSSAAS 95
            :||:.:..|.||..  :::..|:.:.||.:.|..:...:|.|....| :.||.....|||.....
  Fly    81 SLDVTSSSSIGSET--SISSTGSTAIAGPSTLLDDSNSSGLGLVVDV-DSNGSSQELSSHGVTEL 142

  Fly    96 TASSNTGSESVTSDQDQSDK--------------VSIFSEADSGVVCCSNT---SRPVSYAGTGL 143
            .:..::.|..:..|.|:..|              :.:|.|.....|...:|   |.|.|.:.:..
  Fly   143 DSLEDSCSGLMIKDGDKLCKLCSLRLVMPRILSCLHVFCEDCLQAVVSKDTMSASSPNSCSSSSF 207

  Fly   144 LPGVGNVVAPPGAAYCLTCPLCRKLVFFDDGGVRNLPTYRAMEAIVD-RFCAREALRCQMCETDP 207
               .|:......:|..:.||:|::.......|::.||....:..|:| .....|.:.|..|::..
  Fly   208 ---DGSEHQNRLSAVFIECPVCKQETPLGPKGIKALPCDYIVTNILDLSNLESEHIVCTSCKSKE 269

  Fly   208 KVASLICEQCEIRYCDACRELTHPARGPLAKHTLVKPRGAAQ--------QRESVCGEH-EETLS 263
            :..|. |..|....|:.| :..|........|.:|:.....:        .:...|.:| .|.|.
  Fly   270 EAISR-CNDCANFLCNGC-DNAHKYMRCFENHHVVRIEDLTKNVHDKLIIHKPVFCPQHVSENLK 332

  Fly   264 QYCLSCKAPACGLC-IGELRHQAHDVQSINVTCKAQKTELSHNLQQLSEKA-------RSTTEFI 320
            .||.:|:.|.|..| :.:.:...|..::..|..:|.:.:|...|....:||       .:....:
  Fly   333 YYCFTCQVPTCNDCLLSDHKGSDHHYETATVAEQAVRADLEETLSDTLKKADYCNDAGSNLGSAL 397

  Fly   321 QRLKGMSDKVTESCMEFERLVHAQC-EALIQAIHDRREYLLEAIRMDKDTKIRILKDQQSNCTGK 384
            ..|:...|.|.:...:..:     | :.::::|.|:....|..:..|::.||..|.....|..||
  Fly   398 TELQSQHDTVRQQIEDAYK-----CYKRMLESIKDQMLNELGRLHSDRELKIMDLMQSMENTMGK 457

  Fly   385 LQQTTGLIQFCIEALKETDSAAFLQ----VGSMLINRVTNT 421
            ||...   ||...|:.:.:|..||.    :.:..:|.:..|
  Fly   458 LQHAA---QFGQRAVDKANSIEFLLLKPIISAQCLNLMEQT 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trim9NP_001188786.1 RING-HC_TRIM9_like_C-I 2..37 CDD:319490 2/5 (40%)
zf-B_box 250..291 CDD:306989 11/42 (26%)
ClassIIa_HDAC_Gln-rich-N 298..420 CDD:330228 27/133 (20%)
FN3 472..564 CDD:238020
SPRY_PRY_TRIM67_9 561..735 CDD:293947
mei-P26NP_001356936.1 RING_Ubox 158..230 CDD:354325 14/74 (19%)
BBOX 321..360 CDD:237988 11/38 (29%)
BBC 369..494 CDD:128778 27/132 (20%)
NHL_brat_like 913..1186 CDD:271329
NHL repeat 936..972 CDD:271329
NHL repeat 983..1025 CDD:271329
NHL repeat 1028..1064 CDD:271329
NHL repeat 1068..1107 CDD:271329
NHL repeat 1112..1151 CDD:271329
NHL repeat 1157..1183 CDD:271329
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447032
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.