DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trim9 and Fsd1

DIOPT Version :9

Sequence 1:NP_001188786.1 Gene:Trim9 / 34453 FlyBaseID:FBgn0051721 Length:740 Species:Drosophila melanogaster
Sequence 2:NP_899001.1 Gene:Fsd1 / 240121 MGIID:1934858 Length:496 Species:Mus musculus


Alignment Length:478 Identity:112/478 - (23%)
Similarity:183/478 - (38%) Gaps:126/478 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 QKTELSHNLQQLSEKARSTTEFIQRLKGMSDKVTESCMEFERLVHAQCEALIQAIHDRREYLLEA 362
            |:..|...:..|:.|...|..||..||.|...|..:..:.:..:.|:.::|...:.:.:|.:|..
Mouse     4 QREALRKIITTLAMKNEETQTFIYSLKQMLLNVEANSAKVQEDLEAEFQSLTSVLEELKESMLMK 68

  Fly   363 IRMDKDTKIRILKDQQSNCTGKLQQTTGLIQFCIEALKETDSAAFLQVGSMLINRVTNTDMTWHQ 427
            |:.|:.::...|::|.:.||..|:.:..|::...:.|:.:||..|.|....:.:.:|        
Mouse    69 IKQDRASRTYELQNQLAACTRALESSEELLETANQTLQASDSEDFSQAAKEIKDGIT-------- 125

  Fly   428 EVTNAAPRVSPIVDLTLDDAALARAIDNL-----NFIQMRAVKDGDERCPAAPMTPTILPSDCSA 487
                    ::|...|:|.    |:..||:     :|.|.|.:....:..| .|..|||..::...
Mouse   126 --------MAPAFRLSLK----AKVSDNMSHLMVDFAQERQMLQALKFLP-VPSAPTIDLAESLV 177

  Fly   488 ENNSVTVAWQPPNH-SFVEGYVLELDDGSGGEFRE----------------VYCG-KETICTVDG 534
            .:|.||:.|..|:. |.::.|||        |:|:                |..| ::|..|:.|
Mouse   178 SDNCVTLVWHMPDEDSKIDHYVL--------EYRKTNFEGPPRLKEDHPWMVVEGIRQTEHTLTG 234

  Fly   535 LHFNSMY-NARVKAFNSAGEGEYSELIGLQT--------------------AEVAW--------- 569
            |.|:..| |.||||.|.|..||:||.:.|:|                    ....|         
Mouse   235 LKFDMKYMNIRVKACNKAVAGEFSEPVTLETPAFMFRLDGSTSHQNLRVEDLSAEWDAMGGKVQD 299

  Fly   570 ----------FTFDPV------------LSGGAGSGLIFSKNNATVSVEGWEHRVALGSVGFSRG 612
                      .|..||            :|.|.|....|:..:.||          ||......|
Mouse   300 IKAREKEGKGRTASPVNSPARGTPSPKRMSSGRGGRDRFTAESYTV----------LGDTLIDGG 354

  Fly   613 VHYWEFTIDNYTADTDPAF--GVARIDVARNKMLGKDEKSFAMYIDRQRSWFQ--HNSIHERRVE 673
            .||||...:    ....||  |||...:.|.:.|||...|:.::.:   :|.|  ..:.|..:|:
Mouse   355 EHYWEVRFE----PDSKAFGLGVAYRSLGRFEQLGKTAASWCLHAN---NWLQASFTAKHANKVK 412

  Fly   674 G-GITTGSTIGVLLDLERHTLSF 695
            . .......:||..|..:..|||
Mouse   413 VLDSPVPDCLGVHCDFHQGLLSF 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trim9NP_001188786.1 RING-HC_TRIM9_like_C-I 2..37 CDD:319490
zf-B_box 250..291 CDD:306989
ClassIIa_HDAC_Gln-rich-N 298..420 CDD:330228 28/121 (23%)
FN3 472..564 CDD:238020 36/110 (33%)
SPRY_PRY_TRIM67_9 561..735 CDD:293947 39/191 (20%)
Fsd1NP_899001.1 iSH2_PI3K_IA_R 4..120 CDD:304922 28/115 (24%)
FN3 165..265 CDD:238020 35/107 (33%)
SPRY_PRY_FSD1 270..476 CDD:293958 37/183 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 301..336 6/34 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24099
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.