DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18302 and LIPF

DIOPT Version :9

Sequence 1:NP_609420.1 Gene:CG18302 / 34452 FlyBaseID:FBgn0032266 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001185758.1 Gene:LIPF / 8513 HGNCID:6622 Length:408 Species:Homo sapiens


Alignment Length:366 Identity:133/366 - (36%)
Similarity:201/366 - (54%) Gaps:34/366 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LIKKYGYPAETHKIQAKDGFVLTAHRIP-------KPGGQPVL-LVHGLLDSSVAYVILGPERSL 102
            :|..:|||.|.:::..:||::|..:|||       ..|.:||: |.||||.|:..::...|..||
Human    48 MITYWGYPNEEYEVVTEDGYILEVNRIPYGKKNSGNTGQRPVVFLQHGLLASATNWISNLPNNSL 112

  Fly   103 GFLLSDMGYDVWLLNTRGNRYSRKHKRYHRYQPQFWDFSFHELGVYDLPAAIDYVLARSKDFEQI 167
            .|:|:|.||||||.|:|||.::|::..|.....:||.|||.|:..|||||.||:::.::.. :|:
Human   113 AFILADAGYDVWLGNSRGNTWARRNLYYSPDSVEFWAFSFDEMAKYDLPATIDFIVKKTGQ-KQL 176

  Fly   168 HYVGHSQGTTSFFVMGSERSAYMKKIKLMQALAPVVFWDYIDSPIILTFVKYLRPLV----FIAR 228
            ||||||||||..|:..|...:..|:||...|||||            ..|||.:.|:    |:.:
Human   177 HYVGHSQGTTIGFIAFSTNPSLAKRIKTFYALAPV------------ATVKYTKSLINKLRFVPQ 229

  Fly   229 S-----FGIYEFPPENEVWRSLIHKICSFVFQN-TCTYFLMEAMGVDYAQFNSSLLPLFTGHASS 287
            |     ||...|.|.|...:.|..::||....| .|:..|....|.|...||:|.|.::..|..:
Human   230 SLFKFIFGDKIFYPHNFFDQFLATEVCSREMLNLLCSNALFIICGFDSKNFNTSRLDVYLSHNPA 294

  Fly   288 GSSVKSLEHYGQQIHSGGFFKYNYYSTWENRRNHGVDTPPQYKLTNVDCKVALYYSRNDRLTSDK 352
            |:||:::.|:.|.:.||.|..|::.|..:||.::....||.|.:|.::..:|::....|.|...:
Human   295 GTSVQNMFHWTQAVKSGKFQAYDWGSPVQNRMHYDQSQPPYYNVTAMNVPIAVWNGGKDLLADPQ 359

  Fly   353 DVVRLRDILPNVVLDYMFPDPLYNHINFIWGNDV-KTVLND 392
            ||..|...|||::  |....|.|||::|||..|. :.|.||
Human   360 DVGLLLPKLPNLI--YHKEIPFYNHLDFIWAMDAPQEVYND 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18302NP_609420.1 PLN02872 13..399 CDD:215470 133/366 (36%)
Abhydro_lipase 43..97 CDD:282003 20/58 (34%)
Abhydrolase_5 79..>208 CDD:289465 60/129 (47%)
LIPFNP_001185758.1 PLN02872 14..400 CDD:215470 133/366 (36%)
Abhydro_lipase 45..107 CDD:282003 20/58 (34%)
Abhydrolase_5 88..>211 CDD:289465 58/123 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141803
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2624
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 271 1.000 Inparanoid score I3005
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55134
OrthoDB 1 1.010 - - D408561at33208
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100408
Panther 1 1.100 - - O PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X80
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.810

Return to query results.
Submit another query.