DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18302 and Lipf

DIOPT Version :9

Sequence 1:NP_609420.1 Gene:CG18302 / 34452 FlyBaseID:FBgn0032266 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_080610.1 Gene:Lipf / 67717 MGIID:1914967 Length:395 Species:Mus musculus


Alignment Length:373 Identity:133/373 - (35%)
Similarity:202/373 - (54%) Gaps:21/373 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DANLITPDLIKKYGYPAETHKIQAKDGFVLTAHRIP-------KPGGQPV-LLVHGLLDSSVAYV 94
            :||:....:|..:|||:|.:::..:||::|..:|||       ..|.:|| .|.|||:.|:..::
Mouse    29 EANMNVSQMITYWGYPSEEYEVVTEDGYILGVYRIPYGKKNSENIGKRPVAYLQHGLIASATNWI 93

  Fly    95 ILGPERSLGFLLSDMGYDVWLLNTRGNRYSRKHKRYHRYQPQFWDFSFHELGVYDLPAAIDYVLA 159
            ...|..||.|:|:|.||||||.|:|||.:|||:..|.....:||.|||.|:..|||||.||:::.
Mouse    94 TNLPNNSLAFILADAGYDVWLGNSRGNTWSRKNVYYSPDSVEFWAFSFDEMAKYDLPATIDFIVQ 158

  Fly   160 RSKDFEQIHYVGHSQGTTSFFVMGSERSAYMKKIKLMQALAPVVFWDYIDSPI--ILTFVKYLRP 222
            ::.. |:|||||||||||..|:..|...|..||||...|||||....|.:||.  |....|:|..
Mouse   159 KTGQ-EKIHYVGHSQGTTIGFIAFSTNPALAKKIKRFYALAPVATVKYTESPFKKISLIPKFLLK 222

  Fly   223 LVFIARSFGIYEFPPENEVWRSLIHKICS-FVFQNTCTYFLMEAMGVDYAQFNSSLLPLFTGHAS 286
            ::     ||...|.|.|.:.:.|..::|| .:....|:..|....|.|....|.|...::.||..
Mouse   223 VI-----FGNKMFMPHNYLDQFLGTEVCSRELLDLLCSNALFIFCGFDKKNLNVSRFDVYLGHNP 282

  Fly   287 SGSSVKSLEHYGQQIHSGGFFKYNYYSTWENRRNHGVDTPPQYKLTNVDCKVALYYSRNDRLTSD 351
            :|:|.:.|.|:.|...||....||:.|..:|..::...|||.|.::.:...:|::...:|.|...
Mouse   283 AGTSTQDLFHWAQLAKSGKLQAYNWGSPLQNMLHYNQKTPPYYDVSAMTVPIAVWNGGHDILADP 347

  Fly   352 KDVVRLRDILPNVVL-DYMFPDPLYNHINFIWGNDVKTVLNDRMIELM 398
            :||..|...|||::. ..:.|   |||::|||..|....:.:.::.:|
Mouse   348 QDVAMLLPKLPNLLYHKEILP---YNHLDFIWAMDAPQEVYNEIVTMM 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18302NP_609420.1 PLN02872 13..399 CDD:215470 133/373 (36%)
Abhydro_lipase 43..97 CDD:282003 19/61 (31%)
Abhydrolase_5 79..>208 CDD:289465 64/129 (50%)
LipfNP_080610.1 PLN02872 35..389 CDD:215470 130/362 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831805
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2624
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 278 1.000 Inparanoid score I2905
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55134
OrthoDB 1 1.010 - - D408561at33208
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100408
Panther 1 1.100 - - O PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X80
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.810

Return to query results.
Submit another query.