DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18302 and LIPJ

DIOPT Version :9

Sequence 1:NP_609420.1 Gene:CG18302 / 34452 FlyBaseID:FBgn0032266 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001010939.2 Gene:LIPJ / 142910 HGNCID:21773 Length:366 Species:Homo sapiens


Alignment Length:371 Identity:127/371 - (34%)
Similarity:206/371 - (55%) Gaps:24/371 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LIKKYGYPAETHKIQAKDGFVLTAHRIP-------KPGGQPVL--LVHGLLDSSVAYVILGPERS 101
            :|..:|||.|.:.|..:||::|..:|||       |...|.|:  |.||||.|:.:::...|..|
Human     6 IISYWGYPDEEYDIVTEDGYILGLYRIPYWRTDNNKNLAQRVVVYLQHGLLTSASSWISNLPNNS 70

  Fly   102 LGFLLSDMGYDVWLLNTRGNRYSRKHKRYHRYQPQFWDFSFHELGVYDLPAAIDYVLARSKDFEQ 166
            |||:|:|.|||||:.|:|||.:||||........:||.|||.|:..|||||:||:.:.:::. |:
Human    71 LGFILADAGYDVWMGNSRGNTWSRKHLYLETSSKEFWAFSFDEMAKYDLPASIDFTVKQTRQ-EE 134

  Fly   167 IHYVGHSQGTTSFFVMGSERSAYMKKIKLMQALAPVVFWDYIDSPIILTFVKYLRPLVFIARSF- 230
            |.|||||||||..|:..|..|...::||:..|||||....|:.||:|....|:..    |..:| 
Human   135 IFYVGHSQGTTIGFITFSTISKIAERIKIFFALAPVFSTKYLKSPLIRMTYKWKS----IVMAFS 195

  Fly   231 GIYEFPPENEVWRSLIHKICSF-VFQNTCTYFLMEAMGVDYAQFNSSLLPLFTGHASSGSSVKSL 294
            |..:|.|:....:.:..|:|.. :|...|...|....|.|....|.|.|.::..|..:|:||:::
Human   196 GNKDFLPKTSFKKFIGSKLCPLQIFDKICLNILFMMFGYDPKNLNMSRLDVYFSHNPAGTSVQNM 260

  Fly   295 EHYGQQIHSGGFFKYNYYSTWENRRNHGVDTPPQYKLTNVDCKVALYYSRNDRLTSDKDVVRLRD 359
            .|:.|.::|.....|::.|...|..::...|.|.|.:||::...|::..::|.|...:||    :
Human   261 LHWSQLLNSTHLKAYDWGSPDLNLVHYNQTTSPLYNMTNMNVATAIWNGKSDLLADPEDV----N 321

  Fly   360 ILPNVVLDYMFPDPL--YNHINFIWGNDVKTVLNDRMIELMRKVDN 403
            ||.:.:.::::...:  ||||:.::|.||...:...:|::::  ||
Human   322 ILHSEITNHIYYKTISYYNHIDSLFGLDVYDQVYHEIIDIIQ--DN 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18302NP_609420.1 PLN02872 13..399 CDD:215470 125/365 (34%)
Abhydro_lipase 43..97 CDD:282003 21/59 (36%)
Abhydrolase_5 79..>208 CDD:289465 61/130 (47%)
LIPJNP_001010939.2 Abhydro_lipase 3..66 CDD:282003 21/59 (36%)
Abhydrolase_5 47..209 CDD:289465 71/166 (43%)
Abhydrolase_1 48..347 CDD:278959 106/307 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141823
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2624
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 271 1.000 Inparanoid score I3005
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55134
OrthoDB 1 1.010 - - D408561at33208
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X80
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.