DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18301 and CG18530

DIOPT Version :9

Sequence 1:NP_609419.1 Gene:CG18301 / 34451 FlyBaseID:FBgn0032265 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_652714.2 Gene:CG18530 / 59241 FlyBaseID:FBgn0042207 Length:389 Species:Drosophila melanogaster


Alignment Length:353 Identity:124/353 - (35%)
Similarity:190/353 - (53%) Gaps:26/353 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LNTIQLISKYGYPAENYTVQSDDGYLLGLFRI------ARPGALP-VLLVHGLMDSSDTWVMMGP 101
            :.:.::|:.:.||.|.:||.:.|||||..|||      .:.|..| ||..||:..|||.:::.||
  Fly    19 ITSAEIIASHNYPVEIHTVVTRDGYLLNAFRIPNSIYCEQSGTKPAVLFQHGMTASSDVFLVNGP 83

  Fly   102 SSSLGYMLYEQGYDVWMANVRGNTYTKRHVRYSAEDSDFWNFSFHEMGIFDLPAIIDYILMQSGF 166
            ..:|.:||.:..:|||::|.||..|::|||.....|.|||.||:||:|..|:.|.|||||..:..
  Fly    84 RDALPFMLADACFDVWLSNSRGTRYSRRHVSLDPSDEDFWRFSWHEIGTEDVAAFIDYILGTTNQ 148

  Fly   167 GQLHYIGHSQGSTIFWILASERPEYMEKIVMMQALAPVAFLSHCRSP----IVNLLASQDTAVAS 227
            ..:||:|||||.|...:|.|.||||.:.:.....|.|..|:.|..:.    :..|:.|....   
  Fly   149 SAVHYVGHSQGCTTLVVLLSMRPEYNQFVKTAILLGPPVFMGHTHTLGQIFLRTLIMSMPDC--- 210

  Fly   228 FLSAAGYNEFLPSNSVIDQFKRYACRDIISSSVCQSLFFILFGFNGQQVNQTMLPIVVGHTPAGA 292
                    ||:..|.::::..|..|...:....|.:.|.|:.|.....:|.:.:|::....|||.
  Fly   211 --------EFMFHNRILNKILRRICGLFVVRVYCSTFFMIVNGKFSDHLNTSAIPLIAATLPAGV 267

  Fly   293 SIRQMHHYGQLRNSGKFQQFDYGLL-NFLHYGSLSPPPYELEKVK--AKVAIYYAKNDWIAPPED 354
            |.||..|:.||.:||:|:.||:|:| |.::|.||:||.|.|..|:  ..|.|:|:.:|..|..||
  Fly   268 SSRQPKHFIQLTDSGRFRPFDFGILRNLINYRSLTPPDYPLHNVRPLTPVHIFYSDDDLSAAKED 332

  Fly   355 VDMLFNRLPNVVEKYLVPNENFNHFDLV 382
            |:.....||..| .:.:...:::|.|.|
  Fly   333 VENFATSLPEAV-MHRISTPSWHHMDFV 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18301NP_609419.1 Abhydro_lipase 46..100 CDD:282003 23/60 (38%)
PLN02872 48..407 CDD:215470 124/349 (36%)
Abhydrolase_5 82..225 CDD:289465 59/147 (40%)
Abhydrolase_5 <327..379 CDD:289465 16/53 (30%)
CG18530NP_652714.2 PLN02872 22..377 CDD:215470 124/350 (35%)
Abhydro_lipase 22..82 CDD:282003 23/59 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439534
Domainoid 1 1.000 108 1.000 Domainoid score I1418
eggNOG 1 0.900 - - E2759_KOG2624
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1188
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D39202at50557
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 1 1.000 - - mtm1092
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X80
109.900

Return to query results.
Submit another query.