DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18301 and mag

DIOPT Version :9

Sequence 1:NP_609419.1 Gene:CG18301 / 34451 FlyBaseID:FBgn0032265 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_649229.1 Gene:mag / 40267 FlyBaseID:FBgn0036996 Length:399 Species:Drosophila melanogaster


Alignment Length:364 Identity:141/364 - (38%)
Similarity:209/364 - (57%) Gaps:36/364 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 ISKYGYPAENYTVQSDDGYLLGLFRI-----------ARPGALPVLLVHGLMDSSDTWVMMGPSS 103
            |..:|||.|.:.|.:.|||:|.||||           .||   |:||.|||..:||.|:..||.:
  Fly    36 IRSHGYPTETHEVTTQDGYVLTLFRIPYSHKLKNQNEKRP---PILLQHGLFSNSDCWLSSGPDN 97

  Fly   104 SLGYMLYEQGYDVWMANVRGNTYTKRHVRYSAEDSDFWNFSFHEMGIFDLPAIIDYILMQSGFGQ 168
            ||.|:|.:.|||||:.|.|||.|::.::..|.....||:|.:||:|..|:||:|||||..:||.|
  Fly    98 SLAYLLADAGYDVWLGNARGNIYSRNNIIISLNSHKFWHFDWHEIGTIDIPAMIDYILADTGFDQ 162

  Fly   169 LHYIGHSQGSTIFWILASERPEYMEKIVMMQALAPVAFLSHCRSPIVNLLASQDTAVASFLSAAG 233
            :||.|||||:|::.::.||||||...|.....|||.||..|..|.|.|       |:...:...|
  Fly   163 IHYAGHSQGTTVYLVMLSERPEYNALIKSGHLLAPCAFFEHGTSFIFN-------ALGPLVGTPG 220

  Fly   234 --YN------EFLPSNSVIDQFKRYACRDIISSSVCQSLFFILFGFNGQQV--NQTMLPIVVGHT 288
              :|      |.:|:|:::::....:|.  :|:::|.:. ||:|. ||..|  |.:.:.:::...
  Fly   221 GIWNQLLVDTELIPNNNLVNRLVDNSCH--LSNTICNNA-FIMFA-NGGYVNANASSMSVLIETH 281

  Fly   289 PAGASIRQMHHYGQLRNSGKFQQFDYGL-LNFLHYGSLSPPPYELEKVKAKVAIYYAKNDWIAPP 352
            |||:|..|..||.||..|.||:|:|:|. .|...||...||.|:|.|:.|...:|.:.||.:..|
  Fly   282 PAGSSSNQGIHYLQLWKSLKFRQYDWGTKKNNELYGQDLPPDYDLSKIVAPTHLYSSTNDALCGP 346

  Fly   353 EDVDMLFNRLPNVVEKYLVPNENFNHFDLVWGRDAKRIL 391
            |||:.|....|::.|.|.||.::|||.|.:..::.|.::
  Fly   347 EDVNTLVENFPHLTEDYRVPVQSFNHLDFIIAKNMKELV 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18301NP_609419.1 Abhydro_lipase 46..100 CDD:282003 25/60 (42%)
PLN02872 48..407 CDD:215470 141/364 (39%)
Abhydrolase_5 82..225 CDD:289465 67/142 (47%)
Abhydrolase_5 <327..379 CDD:289465 21/51 (41%)
magNP_649229.1 Abhydro_lipase 34..94 CDD:282003 25/60 (42%)
MhpC 56..366 CDD:223669 125/323 (39%)
Abhydrolase_5 76..>197 CDD:289465 59/120 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439504
Domainoid 1 1.000 108 1.000 Domainoid score I1418
eggNOG 1 0.900 - - E2759_KOG2624
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 194 1.000 Inparanoid score I1354
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D39202at50557
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 1 1.000 - - mtm1092
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X80
109.900

Return to query results.
Submit another query.