DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18301 and CG17097

DIOPT Version :9

Sequence 1:NP_609419.1 Gene:CG18301 / 34451 FlyBaseID:FBgn0032265 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_609429.1 Gene:CG17097 / 34461 FlyBaseID:FBgn0265264 Length:1087 Species:Drosophila melanogaster


Alignment Length:377 Identity:162/377 - (42%)
Similarity:232/377 - (61%) Gaps:3/377 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EANAFFNPFQLAIPSSVLEDAHLNTIQLISKYGYPAENYTVQSDDGYLLGLFRIARPGALPVLLV 86
            |...|..|..|. ...:|::..|.|:.||.|||||:|...|.|:|||.|.|.||.||||.|||||
  Fly   703 EYKVFKTPNYLT-QEDILDNTKLTTVDLIEKYGYPSETNYVTSEDGYRLCLHRIPRPGAEPVLLV 766

  Fly    87 HGLMDSSDTWVMMGPSSSLGYMLYEQGYDVWMANVRGNTYTKRHVRYSAEDSDFWNFSFHEMGIF 151
            ||||.||.:||.:||...|.|:||.:||||||.|.|||.|::.::....:.:.:|:|||||:|.|
  Fly   767 HGLMASSASWVELGPKDGLAYILYRKGYDVWMLNTRGNIYSRENLNRRLKPNKYWDFSFHEIGKF 831

  Fly   152 DLPAIIDYILMQSGFGQLHYIGHSQGSTIFWILASERPEYMEKIVMMQALAPVAFLSHCRSPIVN 216
            |:||.||:||:.:...::.|||||||||:|:::.||||.|..|:.:||||:|..:|...|||::.
  Fly   832 DVPAAIDHILIHTHKPKIQYIGHSQGSTVFFVMCSERPNYAHKVNLMQALSPTVYLQENRSPVLK 896

  Fly   217 LLASQDTAVASFLSAAGYNEFLPSNSVIDQFKRYACR-DIISSSVCQSLFFILFGFNGQQVNQTM 280
            .|.......:..|:..|..|......:|.||:::.|. ..:.||:|....|:|.||:.:..|.|:
  Fly   897 FLGMFKGKYSMLLNLLGGYEISAKTKLIQQFRQHICSGSELGSSICAIFDFVLCGFDWKSFNTTL 961

  Fly   281 LPIVVGHTPAGASIRQMHHYGQLRNSGKFQQFDYG-LLNFLHYGSLSPPPYELEKVKAKVAIYYA 344
            .|||..|...|||.:|::||.||:....||:||:| :||.:.|.|..||.|.|.:..:||.:::.
  Fly   962 TPIVAAHASQGASAKQIYHYAQLQGDLNFQRFDHGAVLNRVRYESSEPPAYNLSQTTSKVVLHHG 1026

  Fly   345 KNDWIAPPEDVDMLFNRLPNVVEKYLVPNENFNHFDLVWGRDAKRILWNRML 396
            :.||:....||..|..||||:||...|..|.|:|||....:|.:.:|::.:|
  Fly  1027 EGDWLGSTSDVIRLQERLPNLVESRKVNFEGFSHFDFTLSKDVRPLLYSHVL 1078

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18301NP_609419.1 Abhydro_lipase 46..100 CDD:282003 35/53 (66%)
PLN02872 48..407 CDD:215470 155/351 (44%)
Abhydrolase_5 82..225 CDD:289465 71/142 (50%)
Abhydrolase_5 <327..379 CDD:289465 20/51 (39%)
CG17097NP_609429.1 Abhydro_lipase 726..780 CDD:282003 35/53 (66%)
MhpC 746..1061 CDD:223669 139/314 (44%)
Abhydrolase_5 762..>899 CDD:289465 70/136 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438232
Domainoid 1 1.000 108 1.000 Domainoid score I1418
eggNOG 1 0.900 - - E2759_KOG2624
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D39202at50557
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 1 1.000 - - otm46497
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.