DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18301 and SPBC16A3.12c

DIOPT Version :9

Sequence 1:NP_609419.1 Gene:CG18301 / 34451 FlyBaseID:FBgn0032265 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_596777.1 Gene:SPBC16A3.12c / 2539875 PomBaseID:SPBC16A3.12c Length:443 Species:Schizosaccharomyces pombe


Alignment Length:352 Identity:99/352 - (28%)
Similarity:170/352 - (48%) Gaps:19/352 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 NTIQLISKYGYPAENYTVQSDDGYLLGLFRIARPGALP-----VLLVHGLMDSSDTWVMMGPSS- 103
            |..::...:||..|.:.|::.|.::|.|.||..|....     |...||||.:|:.||.:..|. 
pombe    74 NIYEICEAFGYRVEEHLVRTQDNFILCLHRITHPKQSQHKREVVYCHHGLMTNSELWVAVNESER 138

  Fly   104 SLGYMLYEQGYDVWMANVRGNTYTKRHVRYSAEDSDFWNFSFHEMGIFDLPAIIDYILMQSGFGQ 168
            ||.::|.|.|||||:.|.|||.|:::|:.|..:|.:|||||..:|.:||:|..:||||.::|..:
pombe   139 SLPFVLIESGYDVWLGNNRGNKYSRKHITYKPKDEEFWNFSLDDMAMFDIPDTVDYILRETGREK 203

  Fly   169 LHYIGHSQGSTIFWILASERPEYMEKIVMMQALAPVAFLSHCRSPIVNLLASQDTAVASFLSAAG 233
            |:|||.|||:.......|..|:..:|:.:...|||........:..|:.:...:..:...|  .|
pombe   204 LNYIGFSQGTAQAMAALSINPDLNDKVNIFIGLAPAYAPKGFSNYFVDYIVKVNPKIMYHL--FG 266

  Fly   234 YNEFLPSNSVIDQFKRYACRDIISSSVCQSLFFILFGFNGQQVNQTMLPIVVGHTPAGASIRQMH 298
            ....|||.:    |.:..|...|...:......|||.::...::.........|..:.:|::.:.
pombe   267 RRCLLPSVT----FWQNICYPPIFVKIVDVSLKILFNWDLSNISLNQKLCGYAHLYSFSSVKSVV 327

  Fly   299 HYGQLRNSGKFQQFDYGLLNFLHYGS--LSPPPYELEKVKAKVAIYYAKNDWIAPPEDVDMLFNR 361
            |:.|:..:..||.:|..:.....|||  ...|.:....:|..:.|.:...|.:.   :::::...
pombe   328 HWLQIIKNCTFQLYDDDMALLAGYGSRHYQVPLFPTNNIKCPMLILWGGKDTLI---NMEVMRTA 389

  Fly   362 LPNVVEKYLVPNENFNHFDLVWGRDAK 388
            ||...::  |...::.|.|.:||:|.|
pombe   390 LPPHAKE--VSIAHYEHLDFLWGQDVK 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18301NP_609419.1 Abhydro_lipase 46..100 CDD:282003 18/58 (31%)
PLN02872 48..407 CDD:215470 98/349 (28%)
Abhydrolase_5 82..225 CDD:289465 54/148 (36%)
Abhydrolase_5 <327..379 CDD:289465 7/51 (14%)
SPBC16A3.12cNP_596777.1 Abhydro_lipase 75..131 CDD:282003 16/55 (29%)
Abhydrolase_1 116..410 CDD:278959 84/304 (28%)
Abhydrolase <171..>242 CDD:304388 28/70 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2624
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1188
OMA 1 1.010 - - QHG55134
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 1 1.000 - - mtm9260
orthoMCL 1 0.900 - - OOG6_100408
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X80
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.