DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG18301 and abhd-11.1

DIOPT Version :9

Sequence 1:	NP_609419.1	Gene:	CG18301 / 34451	FlyBaseID:	FBgn0032265	Length:	422	Species:	Drosophila melanogaster
Sequence 2:	NP_492942.1	Gene:	abhd-11.1 / 185192	WormBaseID:	WBGene00009316	Length:	297	Species:	Caenorhabditis elegans

Alignment Length:	134	Identity:	33/134 - (24%)
Similarity:	61/134 - (45%)	Gaps:	23/134 - (17%)

- Green bases have known domain annotations that are detailed below.

  Fly    77 RPGALPVLLVHGLMDSSDTWVMMGP--SSSLGYMLYEQGYDVWMANVRGNTYTKRHVRYSAEDSD 139
            |....|::||.||..:.:.|:.:|.  |..||.|::.             ...:.|..:|...|
Worm    32 RSKGTPLILVPGLFGTKENWIQVGKDLSQRLGCMVFA-------------VENRNHGSFSKAAS- 82

  Fly   140 FWNFSFHEMGIFDLPAIIDYILMQSGFGQLHYIGHSQGSTIFWILASERPEYMEKI--VMMQALA 202
               .::.||. .||...||::...:|..:::..|||.|......||: .|||..:|  ::::.::
Worm    83 ---MTYEEMA-DDLVGFIDWVRKITGEDKVNLHGHSMGGKAVTQLAT-TPEYSSRIKSLIVEDMS 142

  Fly   203 PVAF 206
            |:.:
Worm   143 PLGY 146

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG18301	NP_609419.1	Abhydro_lipase	46..100	CDD:282003	7/22 (32%)
		PLN02872	48..407	CDD:215470	33/134 (25%)
		Abhydrolase_5	82..225	CDD:289465	32/129 (25%)
		Abhydrolase_5	<327..379	CDD:289465
abhd-11.1	NP_492942.1	PRK10673	36..287	CDD:182637	32/130 (25%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910