DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lip4 and AT1G15060

DIOPT Version :9

Sequence 1:NP_001260356.1 Gene:Lip4 / 34450 FlyBaseID:FBgn0032264 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001319006.1 Gene:AT1G15060 / 838071 AraportID:AT1G15060 Length:578 Species:Arabidopsis thaliana


Alignment Length:309 Identity:67/309 - (21%)
Similarity:113/309 - (36%) Gaps:87/309 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 VKYSTHHAKFWDFTFHEMGKHDIPATMDYI--LNSTGVSQLHYIGHSQGTVVFWIMAS------E 226
            |||.      |||. |.: :.|:||.::|:  .:.....:|..||||.|.::.:.|.|      .
plant   325 VKYD------WDFD-HYL-EEDVPAAIEYVRAQSKPKDGKLFAIGHSMGGILLYAMLSRCAFEGR 381

  Fly   227 KP------------EYMDKIILMQGLAPVAFLKHCRS-PVVN----FLAEWHLSVSLVLKLIGVH 274
            :|            :|......::.|.|:|......| |||.    ..|.:.||......|..::
plant   382 EPSVAAVATLASSVDYTTSNSALKLLIPLANPAEALSVPVVPLGALLAAAFPLSTRPPYVLSWLN 446

  Fly   275 EFLPKNEFI--SMFNRIICDE-TTITKEICSNVIFLTTGFDKLQLNETMLPVIVGHSPAGASTKQ 336
            :.:...:.:  .|..:::.:. .||..::   :|.|||.|                         
plant   447 DLISSTDMMHPEMLEKLVLNNFCTIPAKL---LIQLTTAF------------------------- 483

  Fly   337 MQHFGQLNRSGGFRQYDHGWLRNHWIYGTIDPPSYHLENVRAKVALYYGQNDWLAPPEDVEMLNR 401
             :..|..:|||.|...|                  ||......|....|..|.:.||..||...:
plant   484 -REGGLRDRSGKFYYKD------------------HLPRTSVPVLALAGDRDLICPPAAVEDTVK 529

  Fly   402 KLP-NVVEKYLV---DDKEFNHLDFIWGIDARELLWDRMLEIMRNHENS 446
            ..| |:|...|:   |...:.|.|.:.|..|.|.::..:.|.:.:|:::
plant   530 LFPENLVTYKLLGEPDGPHYAHYDLVGGRLAVEQVYPCITEFLSHHDSA 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lip4NP_001260356.1 PLN02872 88..446 CDD:215470 67/307 (22%)
Abhydro_lipase 88..139 CDD:282003
Abhydrolase_5 121..>253 CDD:289465 25/103 (24%)
Abhydrolase_5 <368..419 CDD:289465 14/54 (26%)
AT1G15060NP_001319006.1 Hydrolase_4 <330..545 CDD:403389 55/263 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11005
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.