DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lip4 and CG14717

DIOPT Version :9

Sequence 1:NP_001260356.1 Gene:Lip4 / 34450 FlyBaseID:FBgn0032264 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001262481.1 Gene:CG14717 / 41412 FlyBaseID:FBgn0265271 Length:306 Species:Drosophila melanogaster


Alignment Length:311 Identity:51/311 - (16%)
Similarity:111/311 - (35%) Gaps:95/311 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 ATPVLLVHGLLDSSATWVMMGPN---KGLGYLLYDQGYDVWMANVRGNTYSRKH--VKYSTHHAK 178
            |.|::::|.|..|..:|..:..|   .||..::              ...:|.|  ..|.|.|:.
  Fly    45 APPIVVMHDLNLSLESWRQVAVNLSQVGLRQVI--------------TVDARNHGLSPYITGHSP 95

  Fly   179 FWDFTFHEMGKHDIPATMDYILNSTGVSQLHYIGHSQGTVVFWIMASEKPEYMDKIILMQGLAPV 243
            .           .:.|.::.:::...::::..:||..|......:|..:|:.::::||:. :.| 
  Fly    96 M-----------HLAADVEALMSHQRLNKIVALGHGMGGRAMMTLALTQPQLVERVILVD-ITP- 147

  Fly   244 AFLKHCRSPVVNFLAEWHLSVSLVLKLIGVHEFLPKNEFIS--------MFNRIICDETTITKEI 300
                   :||.   :.::|:..:...::.|...:|.|..:|        :|..::.|.:.:.:  
  Fly   148 -------APVP---SNFYLTRQVFEMMLQVAPSIPSNLSLSEGRTFILPLFQDVVHDASELRR-- 200

  Fly   301 CSNVIFLTTGFDKLQLNETMLPVIVGHSPAGASTKQMQHFGQLNRS-----GGFRQYDHGWLRNH 360
               :|:   ...|:|.|.....|    :|...    :..:|::..:     ||.|.|        
  Fly   201 ---IIY---NLRKMQDNTFGWAV----NPQAV----LSSWGEMMINYEATLGGLRPY-------- 243

  Fly   361 WIYGTIDPPSYHLENVRAKVALYYGQNDWLAPPEDVEMLNRKLPNVVEKYL 411
                            ..:|.|..|..........:.::.|..||.|.:.|
  Fly   244 ----------------MGEVLLIAGSQSEFVTTTSIAVMQRYFPNTVVQIL 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lip4NP_001260356.1 PLN02872 88..446 CDD:215470 51/311 (16%)
Abhydro_lipase 88..139 CDD:282003 6/19 (32%)
Abhydrolase_5 121..>253 CDD:289465 22/136 (16%)
Abhydrolase_5 <368..419 CDD:289465 8/44 (18%)
CG14717NP_001262481.1 MhpC 28..299 CDD:223669 51/311 (16%)
Abhydrolase_5 47..>165 CDD:289465 25/154 (16%)
Abhydrolase <249..301 CDD:304388 7/30 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.