DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lip4 and CG3635

DIOPT Version :9

Sequence 1:NP_001260356.1 Gene:Lip4 / 34450 FlyBaseID:FBgn0032264 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_610138.4 Gene:CG3635 / 35447 FlyBaseID:FBgn0032981 Length:425 Species:Drosophila melanogaster


Alignment Length:376 Identity:136/376 - (36%)
Similarity:219/376 - (58%) Gaps:13/376 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 DSHLNTYSLIKKYGYPAENHTLETDDGYILTLHRIA---------RPGATPVL-LVHGLLDSSAT 134
            |.|..|.:.|..:.||.|.||:.|.|.||||::||.         |.|...|: |.||:|.:|..
  Fly    46 DGHKVTATSISNHNYPVEEHTVITHDDYILTIYRIPSSPNRSHLNRAGRRAVVFLQHGILSASDD 110

  Fly   135 WVMMGPNKGLGYLLYDQGYDVWMANVRGNTYSRKHVKYSTHHAKFWDFTFHEMGKHDIPATMDYI 199
            |::.||...|.|:|.|.|||||:.|.|||||||:|.......:.||.|::||:|.:|:.|.:||.
  Fly   111 WIINGPEASLAYMLADAGYDVWLGNARGNTYSRQHKHIHPDTSDFWRFSWHEIGVYDLAAMLDYA 175

  Fly   200 LNSTGVSQLHYIGHSQGTVVFWIMASEKPEYMDKIILMQGLAPVAFLKHCRSPVVNFLAEWHLSV 264
            |..:..|.||::.|||||..|:::.|..|.|.:|:..:..|||:|:::. .|.:::.|....|..
  Fly   176 LAKSQSSSLHFVAHSQGTTAFFVLMSSLPLYNEKLRSVHLLAPIAYMRD-HSFILSKLGGIFLGT 239

  Fly   265 -SLVLKLIGVHEFLPKNEFISMFNRIICDETTITKEICSNVIFLTTGFDKLQLNETMLPVIVGHS 328
             |.:..::|..|.||......:....||..:::...:||.::....|:....||:|:||.:....
  Fly   240 PSFLSWVLGSMELLPITNLQKLICEHICSSSSMFNFLCSGLLDFIGGWGTRHLNQTLLPDVCATH 304

  Fly   329 PAGASTKQMQHFGQLNRSGGFRQYDHGWLRNHWIYGTIDPPSYHLENVRAKVALYYGQNDWLAPP 393
            |||||:.|:.|:.||.|||.|||||||...|..||....||||:::.:::.|.:||.:||:::..
  Fly   305 PAGASSSQVIHYLQLYRSGDFRQYDHGPELNEIIYQQPTPPSYNVQYIKSCVDMYYSENDYMSAV 369

  Fly   394 EDVEMLNRKLPNVVEKYLVDDKEFNHLDFIWGIDARELLWDRMLEIMRNHE 444
            .||:.|...|| ..:.|.:..:::||.||:|..:.:|::.:::::.:|.::
  Fly   370 GDVKYLASLLP-CAQLYRIPFRDWNHYDFLWSNNVKEVINNKIIQKIRKYD 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lip4NP_001260356.1 PLN02872 88..446 CDD:215470 133/368 (36%)
Abhydro_lipase 88..139 CDD:282003 23/60 (38%)
Abhydrolase_5 121..>253 CDD:289465 56/132 (42%)
Abhydrolase_5 <368..419 CDD:289465 15/50 (30%)
CG3635NP_610138.4 Abhydro_lipase 55..115 CDD:282003 23/59 (39%)
Abhydrolase_1 97..399 CDD:278959 114/303 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439463
Domainoid 1 1.000 133 1.000 Domainoid score I1290
eggNOG 1 0.900 - - E2759_KOG2624
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 194 1.000 Inparanoid score I1354
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D39202at50557
OrthoFinder 1 1.000 - - FOG0000083
OrthoInspector 1 1.000 - - mtm1092
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X80
109.900

Return to query results.
Submit another query.