DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lrr47 and Lrrc10b

DIOPT Version :9

Sequence 1:NP_001260355.1 Gene:Lrr47 / 34449 FlyBaseID:FBgn0010398 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001104610.1 Gene:Lrrc10b / 278795 MGIID:2685551 Length:292 Species:Mus musculus


Alignment Length:235 Identity:74/235 - (31%)
Similarity:116/235 - (49%) Gaps:31/235 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 IPQKAQPQVR-----MVISKRSEYPIKGFPRT------LKSLTINNSQLVKLSFEICTLRNLTKL 182
            :|..|:.|:|     :.:|.|.   ::..|..      |:.|.::.:.|.:|..||..||.|..|
Mouse    11 LPSDAEEQLRSGEQQLELSGRR---LRRLPSAVCALSRLQKLYVSGTGLRELPEEIEELRELRIL 72

  Fly   183 DVSGNKLTKIPSELGRLP-LTSLHL-GNNLLGTQNDWCWLRGTKLCQSLGELDLSGNGLTYFPPP 245
            .:..|||.::|..|.||| ||.|:| ||.||....|:..|      |||..|.:.||.|..||.|
Mouse    73 ALDFNKLERLPDGLCRLPRLTRLYLGGNRLLALPPDFAQL------QSLRCLWIEGNFLRRFPRP 131

  Fly   246 LVKFESLVSLNLNNNLLSRLPFAIRRMKALRKLYVCSNELESLPSAVEDL-RIDLLDVWGN---C 306
            |::..:|.||.:.:|.|..||..:.||..||.|::..|..|..|.|:..: |:.:||:..|   .
Mouse   132 LLRLVALQSLQMGDNRLRALPAELPRMTGLRGLWLYGNRFEEFPPALLRMGRLHILDLDRNRLGG 196

  Fly   307 FKEFNADAAQQM--YLQKAASNSPQ---PLWLLGARAVDK 341
            |.:.:...|.::  |.....:..|:   .::|:|..||::
Mouse   197 FPDLHPLRALRVFSYDHNPVTGPPRVADTVFLVGEGAVER 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lrr47NP_001260355.1 LRR_8 154..211 CDD:290566 24/64 (38%)
LRR_4 156..194 CDD:289563 13/37 (35%)
leucine-rich repeat 156..178 CDD:275380 7/21 (33%)
leucine-rich repeat 179..199 CDD:275380 7/19 (37%)
leucine-rich repeat 201..228 CDD:275380 10/27 (37%)
leucine-rich repeat 229..274 CDD:275380 18/44 (41%)
leucine-rich repeat 275..298 CDD:275380 8/23 (35%)
Lrrc10bNP_001104610.1 leucine-rich repeat 24..45 CDD:275380 3/23 (13%)
leucine-rich repeat 46..91 CDD:275380 17/44 (39%)
LRR_8 90..148 CDD:290566 26/63 (41%)
LRR_4 90..129 CDD:289563 18/44 (41%)
leucine-rich repeat 92..114 CDD:275380 10/27 (37%)
leucine-rich repeat 115..137 CDD:275380 9/21 (43%)
leucine-rich repeat 138..160 CDD:275380 9/21 (43%)
leucine-rich repeat 161..183 CDD:275380 7/21 (33%)
leucine-rich repeat 184..205 CDD:275380 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.