DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lrr47 and LRR1

DIOPT Version :9

Sequence 1:NP_001260355.1 Gene:Lrr47 / 34449 FlyBaseID:FBgn0010398 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_689542.2 Gene:LRR1 / 122769 HGNCID:19742 Length:414 Species:Homo sapiens


Alignment Length:446 Identity:127/446 - (28%)
Similarity:197/446 - (44%) Gaps:93/446 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKILCEVQVVNR--------------------ATQTNKTPRPVKSTLAIGYKQSARDANGNTKKE 45
            ||:.|||:|::|                    ..||:::..||::.|.|           :|.|:
Human     1 MKLHCEVEVISRHLPALGLRNRGKGVRAVLSLCQQTSRSQPPVRAFLLI-----------STLKD 54

  Fly    46 LEMVLFSGQNKTGNRYKVKDNIHVVHTKFVLDGKTTIGFIQPP-DNLLIKCDPIQLKGFLQTLKL 109
                      |.|.||::::||....||||.:||.|:...:|| |..|.|.....|||||..::|
Human    55 ----------KRGTRYELRENIEQFFTKFVDEGKATVRLKEPPVDICLSKAISSSLKGFLSAMRL 109

  Fly   110 GMDGKDAINLRLNINAATAIPQKAQP----QVRMVISKRSEYPI-KGFPRTLKSLTINNSQLVKL 169
            ...|     ..::...:|..|.|...    :.:|||:.:.:||: |.||.:|:.|..:...||::
Human   110 AHRG-----CNVDTPVSTLTPVKTSEFENFKTKMVITSKKDYPLSKNFPYSLEHLQTSYCGLVRV 169

  Fly   170 SFEICTLRNLTKLDVSGNKLTKIPSELGRL-PLTSLHLGNNLLGTQNDWCWLRGTKLC-----QS 228
            ...:..|::|.|||:|.|.:.|:|:.:|.| .|..|:|.:|.|.:.:       ..||     :|
Human   170 DMRMLCLKSLRKLDLSHNHIKKLPATIGDLIHLQELNLNDNHLESFS-------VALCHSTLQKS 227

  Fly   229 LGELDLSGNGLTYFPPPLVKFESLVSLNLNNNLLSRLPFAIRRMKALRKLYVCSNELESLPSAVE 293
            |..||||.|.:...|....:.:.|.:|.|::|.|.:.|..|.::..||.|....|:|..|||...
Human   228 LRSLDLSKNKIKALPVQFCQLQELKNLKLDDNELIQFPCKIGQLINLRFLSAARNKLPFLPSEFR 292

  Fly   294 DLRIDLLDVWGNCFKEFNADAAQQMYLQKAASNSPQPLWLLGARAVDKYMLPLSAGSIPAVLIDL 358
            :|.::.||::||.|:       |...|......:|..|....||.:....:|..:..||..|...
Human   293 NLSLEYLDLFGNTFE-------QPKVLPVIKLQAPLTLLESSARTILHNRIPYGSHIIPFHLCQD 350

  Fly   359 IREAPRCPCGELCYAQRKEDLFQRVVQPKFI---TVKNLTYSREHQIYADVVLCDS 411
            :..|..|.||..|.             ..||   |..||     |.:...|||.|:
Human   351 LDTAKICVCGRFCL-------------NSFIQGTTTMNL-----HSVAHTVVLVDN 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lrr47NP_001260355.1 LRR_8 154..211 CDD:290566 19/57 (33%)
LRR_4 156..194 CDD:289563 12/37 (32%)
leucine-rich repeat 156..178 CDD:275380 5/21 (24%)
leucine-rich repeat 179..199 CDD:275380 9/19 (47%)
leucine-rich repeat 201..228 CDD:275380 7/31 (23%)
leucine-rich repeat 229..274 CDD:275380 14/44 (32%)
leucine-rich repeat 275..298 CDD:275380 9/22 (41%)
LRR1NP_689542.2 LRR 1 155..176 4/20 (20%)
leucine-rich repeat 156..178 CDD:275380 5/21 (24%)
LRR_RI <176..261 CDD:238064 30/91 (33%)
LRR_8 177..238 CDD:290566 24/67 (36%)
LRR 2 178..199 9/20 (45%)
leucine-rich repeat 179..201 CDD:275380 10/21 (48%)
LRR 3 201..222 7/27 (26%)
leucine-rich repeat 202..227 CDD:275380 7/31 (23%)
LRR 4 227..248 8/20 (40%)
leucine-rich repeat 228..250 CDD:275380 7/21 (33%)
LRR 5 250..271 7/20 (35%)
leucine-rich repeat 251..273 CDD:275380 7/21 (33%)
LRR 6 273..294 8/20 (40%)
leucine-rich repeat 274..295 CDD:275380 8/20 (40%)
LRR 7 295..316 7/27 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155483
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9TQ
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32677
Inparanoid 1 1.050 139 1.000 Inparanoid score I4505
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48628
OrthoDB 1 1.010 - - D1397717at2759
OrthoFinder 1 1.000 - - FOG0007359
OrthoInspector 1 1.000 - - oto90828
orthoMCL 1 0.900 - - OOG6_108324
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3791
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.700

Return to query results.
Submit another query.