DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6094 and prfB

DIOPT Version :10

Sequence 1:NP_609416.1 Gene:CG6094 / 34446 FlyBaseID:FBgn0032261 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_417367.1 Gene:prfB / 947369 ECOCYCID:EG10762 Length:365 Species:Escherichia coli


Alignment Length:171 Identity:43/171 - (25%)
Similarity:67/171 - (39%) Gaps:45/171 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RVLRQSS-SSGGTGNLLGRQLSYKSDLSLDKIYPGARLQIYTPPPPPSGSDKFSGFIPMDRLEIT 73
            |::|:|. .|||.     |..|:.|.....::.....::|.                |.| |.|.
E. coli   200 RLVRKSPFDSGGR-----RHTSFSSAFVYPEVDDDIDIEIN----------------PAD-LRID 242

  Fly    74 YSRSSGPGGQHVNTVNTKVDV--------------RFKVAQADWIPEQTRQKL--LKVLANRITK 122
            ..|:||.||||||...:.|.:              |.:....|...:|.:.||  |::......|
E. coli   243 VYRTSGAGGQHVNRTESAVRITHIPTGIVTQCQNDRSQHKNKDQAMKQMKAKLYELEMQKKNAEK 307

  Fly   123 DGYFYIKSDLTRSQQMN---LADA-LEKLRTII--RSQEAV 157
            ......|||:....|:.   |.|: ::.|||.:  |:.:||
E. coli   308 QAMEDNKSDIGWGSQIRSYVLDDSRIKDLRTGVETRNTQAV 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6094NP_609416.1 PRK09256 65..200 CDD:181730 33/115 (29%)
prfBNP_417367.1 prfB 3..365 CDD:272858 43/171 (25%)

Return to query results.
Submit another query.