DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6094 and PTH4

DIOPT Version :9

Sequence 1:NP_001260353.1 Gene:CG6094 / 34446 FlyBaseID:FBgn0032261 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_014527.1 Gene:PTH4 / 854035 SGDID:S000005474 Length:202 Species:Saccharomyces cerevisiae


Alignment Length:142 Identity:46/142 - (32%)
Similarity:71/142 - (50%) Gaps:21/142 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 IPMDRLEITYSRSSGPGGQHVNTVNTKVDVRFK-VAQADWIPEQTRQKLLKVLANRITKDGYF-- 126
            :|:::..:.|.|:||||||:||.||:|..:... ::...|||::.|         .|...|.|  
Yeast    64 LPLNQFILRYDRASGPGGQNVNKVNSKCTLTLSGLSNCAWIPQEVR---------NILSSGRFRY 119

  Fly   127 --------YIKSDLTRSQQMNLADALEKLRTIIRSQEAVAPAPPSEETLEKLRRRQERAVRERLQ 183
                    .|:||.|||::.|.....|||...|| |....|...:.||.:|..:.:|:|.:|||.
Yeast   120 YAKGSDSIVIQSDETRSRETNKLKCFEKLVQEIR-QTCQFPNDTTAETSKKWNKIKEKANKERLL 183

  Fly   184 LKRGRAQVKADR 195
            .|:..:..|.:|
Yeast   184 DKKVHSDKKKNR 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6094NP_001260353.1 PRK09256 65..200 CDD:181730 46/142 (32%)
PTH4NP_014527.1 PrfB 1..200 CDD:224107 46/142 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I2509
eggNOG 1 0.900 - - E1_COG1186
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I1737
Isobase 1 0.950 - 0 Normalized mean entropy S1898
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004491
OrthoInspector 1 1.000 - - oto99515
orthoMCL 1 0.900 - - OOG6_102939
Panther 1 1.100 - - LDO PTHR11075
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R778
SonicParanoid 1 1.000 - - X3185
TreeFam 1 0.960 - -
1110.890

Return to query results.
Submit another query.