DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6094 and AT1G62850

DIOPT Version :9

Sequence 1:NP_001260353.1 Gene:CG6094 / 34446 FlyBaseID:FBgn0032261 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001077760.1 Gene:AT1G62850 / 842585 AraportID:AT1G62850 Length:236 Species:Arabidopsis thaliana


Alignment Length:198 Identity:71/198 - (35%)
Similarity:108/198 - (54%) Gaps:12/198 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SAFIRVLRQSSSSGGTGNLLGRQLSYKSDLSLDKIYPG-ARLQIYTPPPPPSGSDKFSGFIPMDR 69
            |..:.|...:|:|||:|.  .|::|.:.......::.. .|.......|.|.        |.:|.
plant    49 SRLVSVRCAASTSGGSGG--DRKVSSRLSQVQQMLHEAEERASSAGNEPTPQ--------ITLDN 103

  Fly    70 LEITYSRSSGPGGQHVNTVNTKVDVRFKVAQADWIPEQTRQKLLKVLANRITKDGYFYIKSDLTR 134
            :.:.::||.|||||:||.:|||||:||.|..|.|:.::.|:|:|....|||.|||...|.|..||
plant   104 VTLNFARSGGPGGQNVNKLNTKVDMRFNVKNAYWLSDRIREKILLTEKNRINKDGELVISSTKTR 168

  Fly   135 SQQMNLADALEKLRTIIRSQEAVAPAPPSEETLEKLRRRQERAVRERLQLKRGRAQVKADRQGPS 199
            :|:.|:.||||||:.||.:...| |.|||||..:|:.:...:|..:||:.|:..:..|:.|:...
plant   169 TQKGNIDDALEKLQAIIDAASYV-PPPPSEEQKKKIVKLAAKADNKRLKSKKVLSDKKSARRSRG 232

  Fly   200 GLD 202
            ..|
plant   233 SYD 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6094NP_001260353.1 PRK09256 65..200 CDD:181730 58/134 (43%)
AT1G62850NP_001077760.1 PRK09256 96..234 CDD:181730 59/146 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 108 1.000 Domainoid score I2166
eggNOG 1 0.900 - - E1_COG1186
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1185
Inparanoid 1 1.050 110 1.000 Inparanoid score I2073
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1611415at2759
OrthoFinder 1 1.000 - - FOG0004491
OrthoInspector 1 1.000 - - oto4109
orthoMCL 1 0.900 - - OOG6_102939
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3185
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.820

Return to query results.
Submit another query.