DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6094 and Mrpl58

DIOPT Version :9

Sequence 1:NP_001260353.1 Gene:CG6094 / 34446 FlyBaseID:FBgn0032261 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001178585.1 Gene:Mrpl58 / 303673 RGDID:1307942 Length:206 Species:Rattus norvegicus


Alignment Length:198 Identity:82/198 - (41%)
Similarity:114/198 - (57%) Gaps:15/198 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LRQSSSSGGT----------GNLLGRQLS---YKSDLSLDKIYPGARLQIYTPPPPPSGSDKFSG 63
            ||.|.|..||          ...|.||::   :||..||||:||.:: .:.|....|..:::.|.
  Rat     7 LRWSLSRAGTLLLPPLARCARRTLHRQVNGTEFKSIYSLDKLYPESK-GVDTAWKVPEHAEQASS 70

  Fly    64 FIPMDRLEITYSRSSGPGGQHVNTVNTKVDVRFKVAQADWIPEQTRQKLLKVLANRITKDGYFYI 128
            .||:|||.|:|.||||||||:||.||:|.:|||.:|.||||.|..|||:.....|:|.|.|...:
  Rat    71 DIPLDRLSISYCRSSGPGGQNVNKVNSKAEVRFHLASADWIAEPVRQKIALTHKNKINKAGELVL 135

  Fly   129 KSDLTRSQQMNLADALEKLRTIIRSQEAVAPAPPSEETLEKLRRRQERAVRERLQLKRGRAQVKA 193
            .|:.:|.|..|||:.|:|:|.:|.....| |..||:|..:..|.|.|:..||||:.||..:.:|.
  Rat   136 TSESSRYQFRNLAECLQKIRDMIAKASQV-PKEPSKEDAQLQRLRIEKMNRERLRQKRINSTIKT 199

  Fly   194 DRQ 196
            .|:
  Rat   200 SRR 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6094NP_001260353.1 PRK09256 65..200 CDD:181730 62/132 (47%)
Mrpl58NP_001178585.1 RF-1 72..202 CDD:305074 61/130 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349585
Domainoid 1 1.000 114 1.000 Domainoid score I5942
eggNOG 1 0.900 - - E1_COG1186
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1185
Inparanoid 1 1.050 128 1.000 Inparanoid score I4574
OMA 1 1.010 - - QHG45970
OrthoDB 1 1.010 - - D1611415at2759
OrthoFinder 1 1.000 - - FOG0004491
OrthoInspector 1 1.000 - - oto96835
orthoMCL 1 0.900 - - OOG6_102939
Panther 1 1.100 - - LDO PTHR11075
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3185
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.