DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6094 and R02F2.9

DIOPT Version :9

Sequence 1:NP_001260353.1 Gene:CG6094 / 34446 FlyBaseID:FBgn0032261 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_498174.1 Gene:R02F2.9 / 259963 WormBaseID:WBGene00019838 Length:165 Species:Caenorhabditis elegans


Alignment Length:145 Identity:59/145 - (40%)
Similarity:85/145 - (58%) Gaps:7/145 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 SGSDKFSGFIPMDRLEITYSRSSGPGGQHVNTVNTKVDVRFKVAQADWIPEQTRQKLLKVLANRI 120
            |.|..|:|.||.:::|..|:.|||||||:|....|||::||||::|:|:.|..|..:.:.|::||
 Worm    19 SSSATFNGVIPTEKIEKRYTLSSGPGGQNVQKNATKVEIRFKVSEAEWLSESLRDLVEEKLSHRI 83

  Fly   121 TKDGYFYIKSDLTRSQQMNLADALEKLRTIIRSQEAVAPAPPSEETLEK----LRRRQERAVRER 181
            ...|...|.||.||.:.:|:||..:|||:.|   .|:.......|..||    ||.|...|.:.|
 Worm    84 NTAGELIIDSDRTRERHLNVADCFDKLRSAI---YAIENEQGKREMTEKDEKILRERAAIATQHR 145

  Fly   182 LQLKRGRAQVKADRQ 196
            ||.||..::.||.|:
 Worm   146 LQEKRRTSEKKASRR 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6094NP_001260353.1 PRK09256 65..200 CDD:181730 55/136 (40%)
R02F2.9NP_498174.1 RF-1 27..160 CDD:392135 54/135 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I4835
eggNOG 1 0.900 - - E1_COG1186
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1185
Inparanoid 1 1.050 101 1.000 Inparanoid score I3570
Isobase 1 0.950 - 0 Normalized mean entropy S1898
OMA 1 1.010 - - QHG45970
OrthoDB 1 1.010 - - D1611415at2759
OrthoFinder 1 1.000 - - FOG0004491
OrthoInspector 1 1.000 - - oto19179
orthoMCL 1 0.900 - - OOG6_102939
Panther 1 1.100 - - LDO PTHR11075
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R778
SonicParanoid 1 1.000 - - X3185
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.910

Return to query results.
Submit another query.