DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6094 and mrpl58

DIOPT Version :9

Sequence 1:NP_001260353.1 Gene:CG6094 / 34446 FlyBaseID:FBgn0032261 Length:203 Species:Drosophila melanogaster
Sequence 2:XP_002940027.3 Gene:mrpl58 / 100170604 XenbaseID:XB-GENE-979343 Length:216 Species:Xenopus tropicalis


Alignment Length:173 Identity:75/173 - (43%)
Similarity:106/173 - (61%) Gaps:9/173 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SYKSDLSLDKIYPGARLQIYTPPPPPSGSDKFSGFIPMDRLEITYSRSSGPGGQHVNTVNTKVDV 94
            :|:|..||:::|||:.|:      ..:..|:....||:|||.|:|.:|||||||:||.||||.:|
 Frog    53 TYRSAYSLERLYPGSDLR------TAALGDQGVADIPVDRLTISYCKSSGPGGQNVNKVNTKAEV 111

  Fly    95 RFKVAQADWIPEQTRQKLLKVLANRITKDGYFYIKSDLTRSQQMNLADALEKLRTIIRSQEAVAP 159
            ||.:|.||||||..|||:.....|||.:.|...:.|:.:|.|..|||..|||:|.|: :..|..|
 Frog   112 RFHLASADWIPEDVRQKISVQCKNRINRSGELIVVSEQSRYQMENLAACLEKIRGIV-ADAAKKP 175

  Fly   160 APPSEETLEKLRRRQERAVRERLQLKRGRAQVKADRQGPSGLD 202
            ...|:|.:|..|.|.|:..|||||.|:..:.:|..|:  :.||
 Frog   176 KMLSKEDVEVRRARVEKMNRERLQQKKIESTIKQSRR--ASLD 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6094NP_001260353.1 PRK09256 65..200 CDD:181730 64/134 (48%)
mrpl58XP_002940027.3 RF-1 82..212 CDD:421865 63/130 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 117 1.000 Domainoid score I5854
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H1185
Inparanoid 1 1.050 128 1.000 Inparanoid score I4532
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1611415at2759
OrthoFinder 1 1.000 - - FOG0004491
OrthoInspector 1 1.000 - - oto103535
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R778
SonicParanoid 1 1.000 - - X3185
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.