DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6094 and mrpl58

DIOPT Version :9

Sequence 1:NP_001260353.1 Gene:CG6094 / 34446 FlyBaseID:FBgn0032261 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001313644.1 Gene:mrpl58 / 100149182 ZFINID:ZDB-GENE-121214-202 Length:193 Species:Danio rerio


Alignment Length:141 Identity:58/141 - (41%)
Similarity:88/141 - (62%) Gaps:1/141 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 SGSDKFSGFIPMDRLEITYSRSSGPGGQHVNTVNTKVDVRFKVAQADWIPEQTRQKLLKVLANRI 120
            |..|:....||:|:|:::||||||.||||||.||||.:|||.|..|||:||..:.::|....:||
Zfish    50 STQDQQLTHIPVDKLKVSYSRSSGAGGQHVNKVNTKAEVRFHVQTADWLPETLKSQILLKHQSRI 114

  Fly   121 TKDGYFYIKSDLTRSQQMNLADALEKLRTIIRSQEAVAPAPPSEETLEKLRRRQERAVRERLQLK 185
            .|.|..:::|:::|||:.||.:.::||..:|:..|. ..|.||.|..|..:.|..:...|||:.|
Zfish   115 NKAGELFVRSEISRSQRRNLQECVQKLTALIQEAEQ-QEAEPSPEDQELWKNRLNKRNLERLKQK 178

  Fly   186 RGRAQVKADRQ 196
            :..:..|..|:
Zfish   179 KIHSATKRARR 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6094NP_001260353.1 PRK09256 65..200 CDD:181730 56/132 (42%)
mrpl58NP_001313644.1 RF-1 58..193 CDD:305074 56/133 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 108 1.000 Domainoid score I6432
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1185
Inparanoid 1 1.050 108 1.000 Inparanoid score I4883
OMA 1 1.010 - - QHG45970
OrthoDB 1 1.010 - - D1611415at2759
OrthoFinder 1 1.000 - - FOG0004491
OrthoInspector 1 1.000 - - oto40030
orthoMCL 1 0.900 - - OOG6_102939
Panther 1 1.100 - - LDO PTHR11075
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R778
SonicParanoid 1 1.000 - - X3185
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1313.060

Return to query results.
Submit another query.